Property Summary

NCBI Gene PubMed Count 30
PubMed Score 10.20
PubTator Score 23.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count
Prostatic Neoplasms 471

Expression

Gene RIF (10)

PMID Text
23600975 the PCDH11X/Y gene pair determines cerebral asymmetry by initiating the right shift in Homo sapiens
22744706 PCDH11Y expression was detected in the fetal neocortex, ganglionic eminences, cerebellum, and inferior olive. In the adult brain, the cerebral cortex, hippocampal formation, and cerebellum and brain stem were immunoreactive.
21276771 Our data...extended the lack of association of late-onset Alzheimer's disease to common PCDH11Y variants.
19859901 The present article investigated the patterns of alternative splicing and expression of the PCDH11X/Y genes.
19125366 We consider that a stronger case can be mounted for the Protocadherin11X/Y gene pair located in the hominid specific Xq21.3/Yp11.2 region of homology that was generated by a duplication from the X
18938061 This study provided the evidence for positive selection on Protocadherin Y gene in human lineage for schizophrenia.
16874762 a candidate for the evolution of hominid-specific characteristics including the sexual dimorphism of cerebral asymmetry, a putative correlate of language
16637074 Our findings suggest a novel mechanism for the progression of CaP involving expression of PCDH-PC. This novel protocadherin induces Wnt signaling, promotes malignant behavior and hormone-resistance of CaP cells.
16331680 Findings do not support the role of PCDH11Y, or more generally of a frequent specific Y chromosome, in the susceptibility to these neuropsychiatric disorders.
12420223 A 4.8 kb cDNA was cloned from TPA-resistance LNCaP prostate cancer cells. It is an unusual protocadherin family gene with 2 large overlapping ORFs encoding homologous polypeptides, one with and one without a signal sequence. [protocadherin-PC]

AA Sequence

MFRVGFLIISSSSSLSPLLLVSVVRVNTTNCHKCLLSGTYIFAVLLVCVVFHSGAQEKNYTIREEIPENV      1 - 70
LIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFY     71 - 140
EVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYEL    141 - 210
IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPV    211 - 280
FKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDRE    281 - 350
ETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDK    351 - 420
DADHNGRVTCFTDHEIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKD    421 - 490
ENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKL    491 - 560
DREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPD    561 - 630
YGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVND    631 - 700
NKPVFIVPPYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEK    701 - 770
CDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTPNTEIADVSSPTS    771 - 840
DYVKILVAAVAGTITVVVVIFITAVVRCRQAPHLKAAQKNMQNSEWATPNPENRQMIMMKKKKKKKKHSP    841 - 910
KNLLLNVVTIEETKADDVDSDGNRVTLDLPIDLEEQTMGKYNWVTTPTTFKPDSPDLARHYKSASPQPAF    911 - 980
QIQPETPLNLKHHIIQELPLDNTFVACDSISNCSSSSSDPYSVSDCGYPVTTFEVPVSVHTRPSQRRVTF    981 - 1050
HLPEGSQESSSDGGLGDHDAGSLTSTSHGLPLGYPQEEYFDRATPSNRTEGDGNSDPESTFIPGLKKEIT   1051 - 1120
VQPTVEEASDNCTQECLIYGHSDACWMPASLDHSSSSQAQASALCHSPPLSQASTQHHSPPVTQTIVLCH   1121 - 1190
SPPVTQTIALCHSPPPIQVSALHHSPPLVQGTALHHSPPSAQASALCYSPPLAQAAAISHSSSLPQVIAL   1191 - 1260
HRSQAQSSVSLQQGWVQGANGLCSVDQGVQGSATSQFYTMSERLHPSDDSIKVIPLTTFAPRQQARPSRG   1261 - 1330
DSPIMETHPL                                                               1331 - 1340
//

Text Mined References (30)

PMID Year Title
23600975 2013 The protocadherin 11X/Y (PCDH11X/Y) gene pair as determinant of cerebral asymmetry in modern Homo sapiens.
22808956 2012 Genetically distinct subsets within ANCA-associated vasculitis.
22744706 2013 Protocadherin 11X/Y a human-specific gene pair: an immunohistochemical survey of fetal and adult brains.
21480486 2011 Non-syndromic language delay in a child with disruption in the Protocadherin11X/Y gene pair.
21276771 2011 Lack of association between protocadherin 11-X/Y (PCDH11X and PCDH11Y) polymorphisms and late onset Alzheimer's disease.
20503398 2010 Relaxin drives Wnt signaling through upregulation of PCDHY in prostate cancer.
19859901 2010 Quantitative analysis of alternative transcripts of human PCDH11X/Y genes.
19812029 2010 Footprints of X-to-Y gene conversion in recent human evolution.
19125366 2009 Where and what is the right shift factor or cerebral dominance gene? A critique of Francks et al. (2007).
18938061 2009 Evidence for positive selection on Protocadherin Y gene in Homo sapiens: implications for schizophrenia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17671842 2007 Replication profile of PCDH11X and PCDH11Y, a gene pair located in the non-pseudoautosomal homologous region Xq21.3/Yp11.2.
17357069 2007 Disruption of ROBO2 is associated with urinary tract anomalies and confers risk of vesicoureteral reflux.
17189292 2007 Structural variation on the short arm of the human Y chromosome: recurrent multigene deletions encompassing Amelogenin Y.
16874762 2006 Accelerated evolution of Protocadherin11X/Y: a candidate gene-pair for cerebral asymmetry and language.
16825765 2006 PCDH11 is X/Y homologous in Homo sapiens but not in Gorilla gorilla and Pan troglodytes.
16741946 2006 Methylation of two Homo sapiens-specific X-Y homologous genes in Klinefelter's syndrome (XXY).
16637074 2006 Protocadherin-PC promotes androgen-independent prostate cancer cell growth.
16331680 2006 Expression and genetic variability of PCDH11Y, a gene specific to Homo sapiens and candidate for susceptibility to psychiatric disorders.
15958572 2005 A human- and male-specific protocadherin that acts through the wnt signaling pathway to induce neuroendocrine transdifferentiation of prostate cancer cells.
15297598 2004 Microsatellite variation and evolutionary history of PCDHX/Y gene pair within the Xq21.3/Yp11.2 hominid-specific homology block.
15274028 2004 ProtocadherinX/Y, a candidate gene-pair for schizophrenia and schizoaffective disorder: a DHPLC investigation of genomic sequence.
14727141 2004 Protocadherin X ( PCDHX) and Y ( PCDHY) genes; multiple mRNA isoforms encoding variant signal peptides and cytoplasmic domains.
14660691 2004 Sex differences in structure and expression of the sex chromosome genes CHD1Z and CHD1W in zebra finches.
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.
12420223 2002 The emergence of protocadherin-PC expression during the acquisition of apoptosis-resistance by prostate cancer cells.
11003707 2000 Conservation of PCDHX in mammals; expression of human X/Y genes predominantly in brain.
10835267 2000 Phylogenetic analysis of the cadherin superfamily allows identification of six major subfamilies besides several solitary members.
10817752 2000 Cadherin superfamily genes: functions, genomic organization, and neurologic diversity.
10716726 2000 Large exons encoding multiple ectodomains are a characteristic feature of protocadherin genes.