Property Summary

NCBI Gene PubMed Count 32
PubMed Score 114.68
PubTator Score 28.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Alzheimer's disease 644 0.0 2.0
Testicular cancer 24 0.0 1.0
Disease Target Count Z-score Confidence
Usher syndrome 34 3.64 1.8
Autistic Disorder 320 3.045 1.5

Expression

Gene RIF (18)

PMID Text
24591081 PCDH11X, expressed in brain is implicated in cell-cell communication, verbal ability, cerebral asymmetry, and dendritic synaptic plasticity, may be regarded as a new candidate gene for dyslexia.
23600975 the PCDH11X/Y gene pair determines cerebral asymmetry by initiating the right shift in Homo sapiens
22744706 PCDH11X expression was detected in the fetal neocortex, ganglionic eminences, cerebellum, and inferior olive. In the adult brain, the cerebral cortex, hippocampal formation, and cerebellum and brain stem were immunoreactive.
21276771 our data...failed to confirm the association between PCDH11X polymorphisms and late-onset Alzheimer's disease
20707987 PCDH11X gene polymorphism does not play a major role in the genetic predisposition to late-onset Alzheimer disease in this Han Chinese population.
20707987 Observational study of gene-disease association. (HuGE Navigator)
20574532 Observational study of gene-disease association. (HuGE Navigator)
20555150 association not found for rs5984894 polymorphism in PCDH11X in Alzheimer's disease in Italy
20555150 Observational study of gene-disease association. (HuGE Navigator)
20523261 An association between late-onset Alzheimer disease and the PCDH11X polymorphisms, was not detected.
20523261 Observational study of gene-disease association. (HuGE Navigator)
19859901 The present article investigated the patterns of alternative splicing and expression of the PCDH11X/Y genes.
19136949 Genetic variation in PCDH11X is associated with susceptibility to late-onset Alzheimer's disease.
19136949 Observational study of gene-disease association. (HuGE Navigator)
19125366 We consider that a stronger case can be mounted for the Protocadherin11X/Y gene pair located in the hominid specific Xq21.3/Yp11.2 region of homology that was generated by a duplication from the X
18502103 This paper proposes that the PCDH11X/Y gene pair generates epigenetic diversity relating to the species capacity for language including predisposition to psychosis.
16874762 a candidate for the evolution of hominid-specific characteristics including the sexual dimorphism of cerebral asymmetry, a putative correlate of language
16825765 By confirming the suspected lack of X-Y homologous status for PCDH11 in non-human primates, our results reinforce the hypothesis of a hominid-specific role for this gene in brain development

AA Sequence

MDLLSGTYIFAVLLACVVFHSGAQEKNYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTG      1 - 70
DVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFP     71 - 140
ATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDRE    141 - 210
EKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGE    211 - 280
NAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVND    281 - 350
NVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLET    351 - 420
AAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSA    421 - 490
MDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSI    491 - 560
IDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNIS    561 - 630
FDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIA    631 - 700
VDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNL    701 - 770
FVNESVTNATLINELVRKSTEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVIFITAVVRCRQAP    771 - 840
HLKAAQKNKQNSEWATPNPENRQMIMMKKKKKKKKHSPKNLLLNFVTIEETKADDVDSDGNRVTLDLPID    841 - 910
LEEQTMGKYNWVTTPTTFKPDSPDLARHYKSASPQPAFQIQPETPLNSKHHIIQELPLDNTFVACDSISK    911 - 980
CSSSSSDPYSVSDCGYPVTTFEVPVSVHTRPPMKEVVRSCTPMKESTTMEIWIHPQPQRKSEGKVAGKSQ    981 - 1050
RRVTFHLPEGSQESSSDGGLGDHDAGSLTSTSHGLPLGYPQEEYFDRATPSNRTEGDGNSDPESTFIPGL   1051 - 1120
KKAAEITVQPTVEEASDNCTQECLIYGHSDACWMPASLDHSSSSQAQASALCHSPPLSQASTQHHSPRVT   1121 - 1190
QTIALCHSPPVTQTIALCHSPPPIQVSALHHSPPLVQATALHHSPPSAQASALCYSPPLAQAAAISHSSP   1191 - 1260
LPQVIALHRSQAQSSVSLQQGWVQGADGLCSVDQGVQGSATSQFYTMSERLHPSDDSIKVIPLTTFTPRQ   1261 - 1330
QARPSRGDSPIMEEHPL                                                        1331 - 1347
//

Text Mined References (33)

PMID Year Title
24591081 2013 Genome-wide copy number scan identifies disruption of PCDH11X in developmental dyslexia.
23600975 2013 The protocadherin 11X/Y (PCDH11X/Y) gene pair as determinant of cerebral asymmetry in modern Homo sapiens.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22808956 2012 Genetically distinct subsets within ANCA-associated vasculitis.
22744706 2013 Protocadherin 11X/Y a human-specific gene pair: an immunohistochemical survey of fetal and adult brains.
21276771 2011 Lack of association between protocadherin 11-X/Y (PCDH11X and PCDH11Y) polymorphisms and late onset Alzheimer's disease.
20707987 2010 Lack of association between PCDH11X genetic variation and late-onset Alzheimer's disease in a Han Chinese population.
20574532 2010 Intermediate phenotypes identify divergent pathways to Alzheimer's disease.
20555150 2010 Failure to replicate an association of rs5984894 SNP in the PCDH11X gene in a collection of 1,222 Alzheimer's disease affected patients.
20523261 2010 PCDH11X variation is not associated with late-onset Alzheimer disease susceptibility.
19859901 2010 Quantitative analysis of alternative transcripts of human PCDH11X/Y genes.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
19136949 2009 Genetic variation in PCDH11X is associated with susceptibility to late-onset Alzheimer's disease.
19125366 2009 Where and what is the right shift factor or cerebral dominance gene? A critique of Francks et al. (2007).
18502103 2008 The 'big bang' theory of the origin of psychosis and the faculty of language.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16874762 2006 Accelerated evolution of Protocadherin11X/Y: a candidate gene-pair for cerebral asymmetry and language.
16825765 2006 PCDH11 is X/Y homologous in Homo sapiens but not in Gorilla gorilla and Pan troglodytes.
15905963 2005 delta-Protocadherins: a gene family expressed differentially in the mouse brain.
15772651 2005 The DNA sequence of the human X chromosome.
14727141 2004 Protocadherin X ( PCDHX) and Y ( PCDHY) genes; multiple mRNA isoforms encoding variant signal peptides and cytoplasmic domains.
14660691 2004 Sex differences in structure and expression of the sex chromosome genes CHD1Z and CHD1W in zebra finches.
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.
11003707 2000 Conservation of PCDHX in mammals; expression of human X/Y genes predominantly in brain.
10835267 2000 Phylogenetic analysis of the cadherin superfamily allows identification of six major subfamilies besides several solitary members.
10817752 2000 Cadherin superfamily genes: functions, genomic organization, and neurologic diversity.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.
10716726 2000 Large exons encoding multiple ectodomains are a characteristic feature of protocadherin genes.
10644456 1999 Identification of a novel protocadherin gene (PCDH11) on the human XY homology region in Xq21.3.
9110174 1997 Large-scale concatenation cDNA sequencing.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8619474 1996 A "double adaptor" method for improved shotgun library construction.