Property Summary

NCBI Gene PubMed Count 21
PubMed Score 20.50
PubTator Score 16.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Asthma 349 3.372 1.7

Expression

Gene RIF (7)

PMID Text
26227965 PCDH1 is important for airway function as a physical barrier, and its dysfunction is involved in the pathogenesis of allergic airway inflammation.
26209277 PCDH1 and SMAD3 act in a single pathway in asthma susceptibility that affects sensitivity of the airway epithelium to TGF-beta.
23988763 Common variations in PCDH1 increase the risk of developing both transient early asthma and atopic dermatitis in early childhood
23050600 genetic polymorphism is associated with subphenotypes of asthma in German children
21982948 PCDH1 transcripts display remarkable variability in expression of conserved intracellular signaling domains; enhanced PCDH1 expression levels strongly correlate with differentiation of bronchial epithelial cells.
21929597 PCDH1 gene variant IVS3-116 associates with eczema in two independent birth cohorts in Netherlands.
19729670 PCDH1 is a novel gene for BHR in adults and children. Its identification as a BHR susceptibility gene may suggest that a structural defect in the integrity of the airway epithelium and contributes to the development of BHR.

AA Sequence

MDSGAGGRRCPEAALLILGPPRMEHLRHSPGPGGQRLLLPSMLLALLLLLAPSPGHATRVVYKVPEEQPP      1 - 70
NTLIGSLAADYGFPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSI     71 - 140
TDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAG    141 - 210
PEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKF    211 - 280
ERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDL    281 - 350
STLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVS    351 - 420
DRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTN    421 - 490
SLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPE    491 - 560
TGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSP    561 - 630
VGMVTVIDGDKGENAQVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVG    631 - 700
VTINVLDENDNAPYITAPSNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSH    701 - 770
SGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNETLANRTLLETLLGHSLDTPLDIDIAG    771 - 840
DPEYERSKQRGNILFGVVAGVVAVALLIALAVLVRYCRQREAKSGYQAGKKETKDLYAPKPSGKASKGNK    841 - 910
SKGKKSKSPKPVKPVEDEDEAGLQKSLKFNLMSDAPGDSPRIHLPLNYPPGSPDLGRHYRSNSPLPSIQL    911 - 980
QPQSPSASKKHQVVQDLPPANTFVGTGDTTSTGSEQYSDYSYRTNPPKYPSKQVGQPFQLSTPQPLPHPY    981 - 1050
HGAIWTEVWE                                                               1051 - 1060
//

Text Mined References (28)

PMID Year Title
26227965 2015 Protocadherin-1 is a glucocorticoid-responsive critical regulator of airway epithelial barrier function.
26209277 2015 Protocadherin-1 binds to SMAD3 and suppresses TGF-?1-induced gene transcription.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23988763 2014 The PCDH1 gene and asthma in early childhood.
23406873 2013 A genome-wide meta-analysis identifies two novel loci associated with high myopia in the Han Chinese population.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
23050600 2012 Genetic variants in Protocadherin-1, bronchial hyper-responsiveness, and asthma subphenotypes in German children.
21982948 2012 Characterization of protocadherin-1 expression in primary bronchial epithelial cells: association with epithelial cell differentiation.
21929597 2012 Protocadherin-1 polymorphisms are associated with eczema in two Dutch birth cohorts.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19729670 2009 Identification of PCDH1 as a novel susceptibility gene for bronchial hyperresponsiveness.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10835267 2000 Phylogenetic analysis of the cadherin superfamily allows identification of six major subfamilies besides several solitary members.
10817752 2000 Cadherin superfamily genes: functions, genomic organization, and neurologic diversity.
10716726 2000 Large exons encoding multiple ectodomains are a characteristic feature of protocadherin genes.
9132272 1995 Human chromosome-specific cDNA libraries: new tools for gene identification and genome annotation.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8508762 1993 Protocadherins: a large family of cadherin-related molecules in central nervous system.