Property Summary

NCBI Gene PubMed Count 44
PubMed Score 126.65
PubTator Score 71.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Propionic acidemia 16 7.67 3.8
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Refractive error 50 0.0 3.0
Disease Target Count Z-score Confidence
Cholangiocarcinoma 35 4.578 2.3
Cleft Lip 141 3.084 1.5

Expression

  Differential Expression (10)

Disease log2 FC p
adrenocortical carcinoma -1.003 4.0e-03
glioblastoma -1.100 1.2e-03
inflammatory breast cancer -1.200 8.4e-03
interstitial cystitis -1.200 1.6e-03
intraductal papillary-mucinous adenoma (... 1.500 2.7e-03
lung cancer 4.500 1.8e-07
osteosarcoma -1.414 4.2e-05
ovarian cancer -2.300 2.5e-09
pancreatic ductal adenocarcinoma liver m... -1.596 8.1e-03
tuberculosis 1.100 1.0e-05

 OMIM Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (17)

AA Sequence

MAGFWVGTAPLVAAGRRGRWPPQQLMLSAALRTLKHVLYYSRQCLMVSRNLGSVGYDPNEKTFDKILVAN      1 - 70
RGEIACRVIRTCKKMGIKTVAIHSDVDASSVHVKMADEAVCVGPAPTSKSYLNMDAIMEAIKKTRAQAVH     71 - 140
PGYGFLSENKEFARCLAAEDVVFIGPDTHAIQAMGDKIESKLLAKKAEVNTIPGFDGVVKDAEEAVRIAR    141 - 210
EIGYPVMIKASAGGGGKGMRIAWDDEETRDGFRLSSQEAASSFGDDRLLIEKFIDNPRHIEIQVLGDKHG    211 - 280
NALWLNERECSIQRRNQKVVEEAPSIFLDAETRRAMGEQAVALARAVKYSSAGTVEFLVDSKKNFYFLEM    281 - 350
NTRLQVEHPVTECITGLDLVQEMIRVAKGYPLRHKQADIRINGWAVECRVYAEDPYKSFGLPSIGRLSQY    351 - 420
QEPLHLPGVRVDSGIQPGSDISIYYDPMISKLITYGSDRTEALKRMADALDNYVIRGVTHNIALLREVII    421 - 490
NSRFVKGDISTKFLSDVYPDGFKGHMLTKSEKNQLLAIASSLFVAFQLRAQHFQENSRMPVIKPDIANWE    491 - 560
LSVKLHDKVHTVVASNNGSVFSVEVDGSKLNVTSTWNLASPLLSVSVDGTQRTVQCLSREAGGNMSIQFL    561 - 630
GTVYKVNILTRLAAELNKFMLEKVTEDTSSVLRSPMPGVVVAVSVKPGDAVAEGQEICVIEAMKMQNSMT    631 - 700
AGKTGTVKSVHCQAGDTVGEGDLLVELE                                              701 - 728
//

Text Mined References (48)

PMID Year Title