Property Summary

NCBI Gene PubMed Count 78
PubMed Score 76.35
PubTator Score 82.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Rheumatoid Arthritis 1.200 2.6e-02
osteosarcoma 2.090 3.1e-05
atypical teratoid / rhabdoid tumor 1.200 2.3e-03
medulloblastoma, large-cell 1.600 9.3e-04
intraductal papillary-mucinous carcinoma... 1.200 2.6e-04
Alzheimer's disease 1.100 2.4e-02
Pick disease 1.900 2.9e-07

Gene RIF (45)

PMID Text
26896798 alphaCP1/ alphaCP2 binding to a cytosine-rich subset of polypyrimidine tracts drives a novel pathway of cassette exon splicing in the mammalian transcriptome.
26803058 beta2-adrenergic receptor signaling promotes pancreatic ductal adenocarcinoma progression by facilitating PCBP2-dependent c-myc expression.
26722446 our data indicate that miR-214 may function as tumor suppressor in glioma by targeting PCBP2
26116532 PCBP2 knockdown promoted angiotensin II-induced hypertrophy (increase in cell size, protein synthesis and activation of fetal genes) of cardiomyocytes, while PCBP2 overexpression obtained oppose effects.
26002461 Protein and mRNA levels of PCBP2 were down-regulated under insulin-resistant conditions. Over-expression of PCBP2 inhibits HIF1alpha and STAT3 pathway.
25717101 STAT3 functions via cellular PCBP2 to regulate B-cell lytic susceptibility by restraining Epstein-Barr Virus lytic activation.
25496916 Poly(rC) binding protein 2 (PCBP2) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
24843120 PCBP1 and PCBP2 may serve as iron chaperones to multiple classes of cytosolic nonheme iron enzymes and may have a particular role in restoring metal cofactors that are spontaneously lost in iron deficient cells.
24796666 PCBP2-depletion induces apoptosis in gastric cancer cells via up-regulating expression of pro-apoptotic proteins and down-regulating anti-apoptotic proteins. miR-34a is a target of PCBP2, and miR-34a is critically essential for the function of PCBP2.
24607900 SIRT6 inhibits glioma cell proliferation and colony formation in vitro and glioma cell growth in vivo in a PCBP2 dependent manner. SIRT6 inhibits PCBP2 expression through deacetylating H3K9ac and SIRT6 acts as a tumor suppressor in glioma.
24418535 PCBP2 and PTB are differentially cleaved by human rhinovirus proteinase in infected cells.
24371074 Inhibition of poliovirus-induced cleavage of cellular PCBP2 protein reduces the viral RNA replication.
23640898 PCBP1 and -2 form a complex for iron delivery to ferritin, and all PCBPs may share iron chaperone activity.
23629627 PCBP2 controls the 3' processing of its own transcript.
23585479 PCBP2 is an RNA-binding protein that modulates glioma growth by regulating FHL3
22633452 Cytosolic iron may modulate the association between PCBP2 and Dicer, as well as the multimerization of PCBP2 and its ability to bind to miRNA precursors
22438951 PCBP2 specifically and selectively interacts with rabies virus glycoprotein mRNA and this interaction may contribute to the post-transcriptional regulation of glycoprotein expression
22022391 PCBP2 stabilizes the mRNA of STAT1 and STAT2 through binding the 3'Untranslated Region (UTR) of these two molecules.
21752917 Overall, the results presented here suggest that cellular PCBP2 and PCBP1 antagonize vesiculovirus growth by affecting viral gene expression and highlight the importance of these two cellular proteins in restricting virus infections.
21723381 SRp75 inhibits splicing of tau exon 10 by binding to the CA repeat in the intronic splicing silencer downstream of the exon, and requires hnRNPG to exert its full regulatory effect on tau exon 10.
21632751 study demonstrates the mechanism of the participation of PCBP2 in hepatitis C virus translation and replication
20211135 Study reports that loss of miR-328 occurs in blast crisis chronic myelogenous leukemia (CML-BC) in a BCR/ABL dose- and kinase-dependent manner through the MAPK-hnRNP E2 pathway.
19945132 The authors established that the 5'CL-PCBP complex is required for optimal poliovirus viral RNA translation and identified the KH3 domain of PCBP2 as the functional region.
19881509 PCBP2-AIP4 axis defines a new signaling cascade for MAVS degradation and 'fine tuning' of antiviral innate immunity.
19808671 Poly(rC) binding protein 2 (PCBP2) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
19230839 Results establish the compositional diversity among P-bodies, and that PCBP2, probably in complex with other mRNP factors, may dynamically recognize such differences and accumulate to specific P-bodies.
19211566 reveal a pivotal role for alphaCP1 and alphaCP2 in a p53-independent pathway of p21(WAF) control and cell cycle progression
18929541 The data demonstrate interaction of isolated PCBP2 KH1 and KH3 domains to four distinct target sites within the 5'-nontranslated region of the CVB3 genomic RNA.
18701464 analysis of the human poly(C)-binding protein containing the first and second KH domains reveals insights into its regulatory mechanisms
18687895 SIN1 and PCBP2 are generally coregulated with large numbers of genes implicated in both cell survival and death and in cellular stress responses, including RNA translation and processing
18656221 The authors showed that the PCBP2 linker domain modulates binding to poliovirus stem-loop IV RNA via a mechanism that is not inhibited by the antibody.
18252259 Using a novel protein-RNA tethering system, We establish PCBP2 as an essential co-factor in the initiation of poliovirus negative-strand synthesis.
18174314 PCBP2 may be involved in stress-induced remodeling of mRNP complexes and that it may also play a role in the rapid transition of certain silenced mRNAs into a translationally active state.
18086560 The interaction of PCBP2 with RNA target sequences at the 5' end of the coxsackievirus B3 genome was investigated.
17672918 validated occurrence of an unusual TG 3' splice site in intron 7
17581994 Study shows that through the loss of the KH3 domain, and therefore loss of its ability to function in translation, PCBP2 can mediate the switch from viral translation to RNA replication.
17526645 Crystal structures of PCBP2 KH1 domain in complex with a 12-nucleotide DNA corresponding to two repeats of the human C-rich strand telomeric DNA and its RNA equivalent.
17426136 molecular model of the interaction of the third KH domain of human poly(C)-binding protein-2 in complex with a C-rich strand of human telomeric DNA.
17219427 Downregulation of HnRNP E2 is associated with oral cancer
17145707 2',5'-oligoadenylate synthetase activation may occur in prostate cancer cells stimulated by cellular mRNAs for PCBP2.
16186123 PCBP2 KH1 binds to C-rich strand of human telomeric DNA, indicating that that PCBPs may participate in mechanisms involved in the regulation of telomere/telomerase functions
15331611 Data suggest that poly(C)-binding protein 2 KH domain 1 interactions with telomeric DNA and telomerase RNA may be involved in the regulation of telomere/telomerase functions.
14612387 deletion of NLS I from alphaCP1 blocks its nuclear accumulation, whereas NLS I and NLS II must both be inactivated to block nuclear accumulation of alphaCP2
12414943 specific PCBP2 domains may have distinct roles for differential picornavirus template utilization during viral translation and RNA replication
12011088 The binding of HuR, CP1, and CP2 to AR mRNA suggests a role for each of these proteins in the post-transcriptional regulation of AR expression in cancer cells.

AA Sequence

MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFK      1 - 70
AFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPN     71 - 140
STERAITIAGIPQSIIECVKQICVVMLETLSQSPPKGVTIPYRPKPSSSPVIFAGGQDRYSTGSDSASFP    141 - 210
HTTPSMCLNPDLEGPPLEAYTIQGQYAIPQPDLTKLHQLAMQQSHFPMTHGNTGFSGIESSSPEVKGYWG    211 - 280
LDASAQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTITGSAASISLAQYL    281 - 350
INVRLSSETGGMGSS                                                           351 - 365
//

Text Mined References (90)

PMID Year Title
26896798 2016 ?CP binding to a cytosine-rich subset of polypyrimidine tracts drives a novel pathway of cassette exon splicing in the mammalian transcriptome.
26803058 2016 ?2-adrenergic receptor signaling promotes pancreatic ductal adenocarcinoma (PDAC) progression through facilitating PCBP2-dependent c-myc expression.
26722446 2015 MicroRNA-214 targets PCBP2 to suppress the proliferation and growth of glioma cells.
26116532 2015 The RNA-binding protein PCBP2 inhibits Ang II-induced hypertrophy of cardiomyocytes though promoting GPR56 mRNA degeneration.
26002461 2015 PCBP2 regulates hepatic insulin sensitivity via HIF-1? and STAT3 pathway in HepG2 cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25717101 2015 Cellular STAT3 functions via PCBP2 to restrain Epstein-Barr Virus lytic activation in B lymphocytes.
25416956 2014 A proteome-scale map of the human interactome network.
24843120 2014 Iron chaperones PCBP1 and PCBP2 mediate the metallation of the dinuclear iron enzyme deoxyhypusine hydroxylase.
24796666 2014 The RNA-binding protein PCBP2 facilitates gastric carcinoma growth by targeting miR-34a.
24607900 2014 The histone deacetylase SIRT6 suppresses the expression of the RNA-binding protein PCBP2 in glioma.
24418535 2014 Differential cleavage of IRES trans-acting factors (ITAFs) in cells infected by human rhinovirus.
24371074 2014 Inhibition of poliovirus-induced cleavage of cellular protein PCBP2 reduces the levels of viral RNA replication.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23640898 2013 Each member of the poly-r(C)-binding protein 1 (PCBP) family exhibits iron chaperone activity toward ferritin.
23629627 2013 ?CP Poly(C) binding proteins act as global regulators of alternative polyadenylation.
23585479 2013 RNA-binding protein PCBP2 modulates glioma growth by regulating FHL3.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22633452 2012 Iron homeostasis regulates the activity of the microRNA pathway through poly(C)-binding protein 2.
22438951 2012 The 3' untranslated region of the rabies virus glycoprotein mRNA specifically interacts with cellular PCBP2 protein and promotes transcript stability.
22022391 2011 PCBP2 enhances the antiviral activity of IFN-? against HCV by stabilizing the mRNA of STAT1 and STAT2.
21752917 2011 Antagonistic effects of cellular poly(C) binding proteins on vesicular stomatitis virus gene expression.
21723381 2011 An SRp75/hnRNPG complex interacting with hnRNPE2 regulates the 5' splice site of tau exon 10, whose misregulation causes frontotemporal dementia.
21632751 2011 Poly(C)-binding protein 2 interacts with sequences required for viral replication in the hepatitis C virus (HCV) 5' untranslated region and directs HCV RNA replication through circularizing the viral genome.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20211135 2010 miR-328 functions as an RNA decoy to modulate hnRNP E2 regulation of mRNA translation in leukemic blasts.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19945132 2010 The 5'CL-PCBP RNP complex, 3' poly(A) tail and 2A(pro) are required for optimal translation of poliovirus RNA.
19881509 2009 PCBP2 mediates degradation of the adaptor MAVS via the HECT ubiquitin ligase AIP4.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19230839 2009 Selective localization of PCBP2 to cytoplasmic processing bodies.
19211566 2009 Depletion of the poly(C)-binding proteins alphaCP1 and alphaCP2 from K562 cells leads to p53-independent induction of cyclin-dependent kinase inhibitor (CDKN1A) and G1 arrest.
19029303 2009 Control of c-myc mRNA stability by IGF2BP1-associated cytoplasmic RNPs.
18929541 2008 Interaction of poly(rC)-binding protein 2 domains KH1 and KH3 with coxsackievirus RNA.
18701464 2008 Structure of a construct of a human poly(C)-binding protein containing the first and second KH domains reveals insights into its regulatory mechanisms.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18687895 2008 A link between SIN1 (MAPKAP1) and poly(rC) binding protein 2 (PCBP2) in counteracting environmental stress.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18656221 2008 The linker domain of poly(rC) binding protein 2 is a major determinant in poliovirus cap-independent translation.
18252259 2008 Protein-RNA tethering: the role of poly(C) binding protein 2 in poliovirus RNA replication.
18174314 2008 Identification of PCBP2, a facilitator of IRES-mediated translation, as a novel constituent of stress granules and processing bodies.
18086560 2008 Poly(rC)-binding protein 2 interacts with the oligo(rC) tract of coxsackievirus B3.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17672918 2007 Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns.
17581994 2007 Cellular protein modification by poliovirus: the two faces of poly(rC)-binding protein.
17526645 2007 X-ray crystallographic and NMR studies of protein-protein and protein-nucleic acid interactions involving the KH domains from human poly(C)-binding protein-2.
17426136 2007 Crystal structure of the third KH domain of human poly(C)-binding protein-2 in complex with a C-rich strand of human telomeric DNA at 1.6 A resolution.
17219427 2007 HnRNP E2 is downregulated in human oral cancer cells and the overexpression of hnRNP E2 induces apoptosis.
17183366 2007 A nucleo-cytoplasmic SR protein functions in viral IRES-mediated translation initiation.
17145707 2006 Selection and cloning of poly(rC)-binding protein 2 and Raf kinase inhibitor protein RNA activators of 2',5'-oligoadenylate synthetase from prostate cancer cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16541075 2006 The finished DNA sequence of human chromosome 12.
16341674 2005 Transcriptome analysis of human gastric cancer.
16186123 2005 Crystal structure of the first KH domain of human poly(C)-binding protein-2 in complex with a C-rich strand of human telomeric DNA at 1.7 A.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15331611 2004 Specific recognition of the C-rich strand of human telomeric DNA and the RNA template of human telomerase by the first KH domain of human poly(C)-binding protein-2.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14612387 2003 A novel set of nuclear localization signals determine distributions of the alphaCP RNA-binding proteins.
12970749 2003 Members of the poly (rC) binding protein family stimulate the activity of the c-myc internal ribosome entry segment in vitro and in vivo.
12527772 2003 Polypyrimidine tract binding protein and poly r(C) binding protein 1 interact with the BAG-1 IRES and stimulate its activity in vitro and in vivo.
12515719 2003 Immunoglobulin light chain variable (V) region genes influence clinical presentation and outcome in light chain-associated amyloidosis (AL).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414943 2002 Distinct poly(rC) binding protein KH domain determinants for poliovirus translation initiation and viral RNA replication.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
12011088 2002 Novel binding of HuR and poly(C)-binding protein to a conserved UC-rich motif within the 3'-untranslated region of the androgen receptor messenger RNA.
10936052 2000 Identification of two novel mammalian genes establishes a subfamily of KH-domain RNA-binding proteins.
10772858 2000 Protein-protein interaction among hnRNPs shuttling between nucleus and cytoplasm.
10455157 1999 A set of highly conserved RNA-binding proteins, alphaCP-1 and alphaCP-2, implicated in mRNA stabilization, are coexpressed from an intronless gene and its intron-containing paralog.
10373504 1999 An mRNA stability complex functions with poly(A)-binding protein to stabilize mRNA in vitro.
10068686 1999 Identification of the poly(C) binding protein in the complex associated with the 3' untranslated region of erythropoietin messenger RNA.
9234743 1997 Identification of AUF1 (heterogeneous nuclear ribonucleoprotein D) as a component of the alpha-globin mRNA stability complex.
9223526 1997 Requirement of poly(rC) binding protein 2 for translation of poliovirus RNA.
8855318 1996 Poly(rC) binding protein 2 binds to stem-loop IV of the poliovirus RNA 5' noncoding region: identification by automated liquid chromatography-tandem mass spectrometry.
8833161 1996 Assignment of human KH-box-containing genes by in situ hybridization: HNRNPK maps to 9q21.32-q21.33, PCBP1 to 2p12-p13, and PCBP2 to 12q13.12-q13.13, distal to FRA12A.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7607214 1995 Characterisation of two major cellular poly(rC)-binding human proteins, each containing three K-homologous (KH) domains.
7556077 1995 Identification of two KH domain proteins in the alpha-globin mRNP stability complex.