Property Summary

NCBI Gene PubMed Count 86
PubMed Score 72.31
PubTator Score 67.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 2.5e-04
Multiple myeloma 1327 2.9e-04
non primary Sjogren syndrome sicca 840 2.6e-02

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.369 2.9e-04
non primary Sjogren syndrome sicca 1.400 2.6e-02
ovarian cancer 2.000 2.5e-04

Gene RIF (52)

PMID Text
26896798 alphaCP1/ alphaCP2 binding to a cytosine-rich subset of polypyrimidine tracts drives a novel pathway of cassette exon splicing in the mammalian transcriptome.
26293996 results showed for the first time that expression of PCBP1 was down-regulated in newly diagnosed acute myeloid leukemia patients
26261610 Suggest that PCBP1 might play an important role in preventing the process of epithelial mesenchymal transformation in NSCLC.
26173642 PCBP1 mutations are recurrent in Burkitt lymphomas and might contribute, in cooperation with other mutations, to its pathogenesis.
26096938 Inhibin betaA is translationally regulated by TGFbeta via hnRNP E1.
25661993 Our proteomic profiling and subsequent validation indicate that PCBP1 is central to cancer stem cells enrichment and functionality in prostate cancer.
25612617 Findings provide mechanistic evidence for HOTAIR overexpression and PCBP1 downregulation in gastric cancer metastasis and their correlation with poor survival.
25505242 The interaction of HIV-1 CA with human cellular poly(rC) binding protein 1 (PCBP1, hnRNP E1: heterogenous nuclear ribonucleoprotein E1) is identified by yeast two-hybrid screen
25496916 The interaction of HIV-1 CA with human cellular poly(rC) binding protein 1 (PCBP1, hnRNP E1: heterogenous nuclear ribonucleoprotein E1) is identified by yeast two-hybrid screen
25389050 hnRNP E1 is a new regulator of protein disulphide isomerase translation in oxLDL-activated vascular endothelial cells.
25268038 A novel mechanism by which POLH expression is controlled by PCBP1 via mRNA stability.
24889597 PCBP1 is a central player in the molecular mechanism causing EMT in GBC-SD cells after TGF-beta treatment; PCBP1 might serve as a useful biomarker for predicting prognosis of gall bladder cancer metastasis
24848140 reduced expression of hnRNP-E1 might be involved with the cervical cancer pathogenesis, with folate playing a role in the natural history of HPV infection
24843120 PCBP1 and PCBP2 may serve as iron chaperones to multiple classes of cytosolic nonheme iron enzymes and may have a particular role in restoring metal cofactors that are spontaneously lost in iron deficient cells.
24819169 SchA-FAK-p85 complex subsequently selectively recruited and activated Akt2, not Akt1
24489926 PCBP1 is a positive regulator involved in regulation of EV71 replication in the host specialized membrane-associated replication complex.
23940783 PCBP1 regulates p63 expression via mRNA stability.
23640898 PCBP1 and -2 form a complex for iron delivery to ferritin, and all PCBPs may share iron chaperone activity.
23629627 a role for PCBP1 in posttranscriptional control pathways that can alter the coding potential and/or levels of expression of subsets of mRNAs in thetranscriptome.
23478261 Stabilization of human eNOS mRNA by hnRNP E1-containing RNP complexes serves as a key protective mechanism against the posttranscriptional inhibitory effects of antisense RNA and microRNA.
23439585 High hnRNP-E1 expression is associated with uraemic patients on hemodialysis.
23125841 The interaction of HIV-1 CA with human cellular poly(rC) binding protein 1 (PCBP1, hnRNP E1: heterogenous nuclear ribonucleoprotein E1) is identified by yeast two-hybrid screen
22801034 Down-regulation of poly(rC)-binding protein 1 correlates with the malignant transformation of hydatidiform moles.
22673507 In HCC patients, the expression of THAP11 mRNA significantly correlated with PCBP1 mRNA expression. Our results suggest a novel role of THAP11 in CD44 alternative splicing and hepatoma invasion
22622828 Poly(rC)-binding protein 1 indirectly regulated MAP2K2, FOS, FST, TP53 and WNT7B through H2AFX.
22105485 Our findings unravel a critical role of PCBP1 in regulating MAVS for both fine-tuning the antiviral immunity and preventing inflammation
22102042 Study on the PCBP1 KH domain recognition of C-rich nucleotides. X-ray diffraction data of PCBP1 were collected to 1.77 Angstrom resolution and the diffraction was consistent with space group P2(1), with unit-cell parameters a = 38.59, b = 111.88, c = 43.42 A, alpha = gamma = 90.0, beta = 93.37 degrees. The unit-cell volume is consistent with the presence of four protein-DNA complexes in the asymmetric unit.
21930702 hnRNP-E1 as a physiologically relevant, sensitive, cellular sensor of folate deficiency.
21752917 Overall, the results presented here suggest that cellular PCBP2 and PCBP1 antagonize vesiculovirus growth by affecting viral gene expression and highlight the importance of these two cellular proteins in restricting virus infections.
20609352 Loss of PRL-3 is associated with cancer.
20519371 PCBP1 plays a major role in the dynamic expression of AR in both male and female androgen-responsive cells.
20361869 We characterized PCBP1 as a negative regulator of CD44 variants splicing in HepG2 cells
19808671 The interaction of HIV-1 CA with human cellular poly(rC) binding protein 1 (PCBP1, hnRNP E1: heterogenous nuclear ribonucleoprotein E1) is identified by yeast two-hybrid screen
19211566 reveal a pivotal role for alphaCP1 and alphaCP2 in a p53-independent pathway of p21(WAF) control and cell cycle progression
19166625 The interaction of HIV-1 CA with human cellular poly(rC) binding protein 1 (PCBP1, hnRNP E1: heterogenous nuclear ribonucleoprotein E1) is identified by yeast two-hybrid screen
18656558 The detailed transcripts and translatants targeted by PCBP1 at a global level.
18511687 PCBP1 can function as a cytosolic iron chaperone in the delivery of iron to ferritin
17622584 Specific binding of heterogenous nuclear ribonucleoprotein E1 (hnRNP E1) and U1 small nuclear ribonucleoprotein (snRNP) in the pre-spliceosomal complex was associated with silencing of pseudoexon splicing.
17451601 The interaction of HIV-1 CA with human cellular poly(rC) binding protein 1 (PCBP1, hnRNP E1: heterogenous nuclear ribonucleoprotein E1) is identified by yeast two-hybrid screen
17389360 Signal-dependent and coordinated regulation of transcription, splicing, and translation resides in a single coregulator, PCBP1.
17383969 To define the mechanism of STAT3C suppression of transcript. and/or translational activity of NF-kappaB we found that a alphaCP-1 interacted with STAT3C. alphaCP-1 is a K-homol. domain-containing RNA-binding prot with specific for C-rich pyrimidine tracts
16775011 These results are consistent with a model where hnRNP E1 recruited to A2RE RNA granules by binding to hnRNP A2 inhibits translation of A2RE RNA during granule transport.
16248985 Thus, we did not find evidence for uniquely interacting partner proteins using this approach, but did identify four new lamin A/C interactive partners
15933215 PCBPs act as a transcription factor and positively regulate mu opioid receptor gene expression in NMB cells
15514164 hnRNPE1 is a positive effector of collagen synthesis acting at the post-transcriptional level by interaction with the 3'-untranslated regions (3'-UTRs) of COL1A1, 1A2 mRNAs.
15246275 Kaposi's sarcoma-associated herpesvirus ORF57 binds to PCBP1 as a functional partner for posttranscriptional regulation and is involved in the regulation of the expression of both cellular and viral genes through IRESs.
15169918 The interactions of PTB-1 and PCBP1 with their cognate binding sites on the Bag-1 IRES disrupt many of the RNA-RNA interactions, and this creates a largely unstructured region of approximately 40 nucleotides that could permit ribosome binding.
14612387 deletion of NLS I from alphaCP1 blocks its nuclear accumulation, whereas NLS I and NLS II must both be inactivated to block nuclear accumulation of alphaCP2
12933794 HADHB trifunctional enzyme, human renin, and poly(C)-binding protein are novel renin mRNA-binding proteins that target a cis-element in the 3'-UTR of renin mRNA and regulate renin production
12431987 The 3'-untranslated region of p21WAF1 mRNA is a composite cis-acting sequence bound by RNA-binding proteins from breast cancer cells, including this one.
12414943 PCBP1, a highly homologous isoform of PCBP2, binds to poliovirus stem-loop I with an affinity similar to that of PCBP2
12011088 The binding of HuR, CP1, and CP2 to AR mRNA suggests a role for each of these proteins in the post-transcriptional regulation of AR expression in cancer cells.

AA Sequence

MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIITLTGPTNAIFK      1 - 70
AFAMIIDKLEEDINSSMTNSTAASRPPVTLRLVVPATQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPN     71 - 140
STERAITIAGVPQSVTECVKQICLVMLETLSQSPQGRVMTIPYQPMPASSPVICAGGQDRCSDAAGYPHA    141 - 210
THDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQT    211 - 280
THELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTITGSAASISLAQYLINARLSSE    281 - 350
KGMGCS                                                                    351 - 356
//

Text Mined References (100)

PMID Year Title
26896798 2016 ?CP binding to a cytosine-rich subset of polypyrimidine tracts drives a novel pathway of cassette exon splicing in the mammalian transcriptome.
26293996 2015 Downregulated Poly-C binding protein-1 is a novel predictor associated with poor prognosis in Acute Myeloid Leukemia.
26261610 2015 Expression of poly(C)-binding protein 1 (PCBP1) in NSCLC as a negative regulator of EMT and its clinical value.
26173642 2015 The PCBP1 gene encoding poly(rC) binding protein I is recurrently mutated in Burkitt lymphoma.
26096938 2016 Translational regulation of inhibin ?A by TGF? via the RNA-binding protein hnRNP E1 enhances the invasiveness of epithelial-to-mesenchymal transitioned cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25661993 2015 Poly r(C) binding protein-1 is central to maintenance of cancer stem cells in prostate cancer cells.
25612617 2015 HOTAIR Long Noncoding RNA Promotes Gastric Cancer Metastasis through Suppression of Poly r(C)-Binding Protein (PCBP) 1.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25389050 2015 Heterogeneous nuclear ribonucleoprotein E1 regulates protein disulphide isomerase translation in oxidized low-density lipoprotein-activated endothelial cells.
25268038 2014 DNA polymerase ? is regulated by poly(rC)-binding protein 1 via mRNA stability.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24889597 2014 PCBP1 is an important mediator of TGF-?-induced epithelial to mesenchymal transition in gall bladder cancer cell line GBC-SD.
24848140 2014 Serum one-carbon metabolites and risk of cervical cancer.
24843120 2014 Iron chaperones PCBP1 and PCBP2 mediate the metallation of the dinuclear iron enzyme deoxyhypusine hydroxylase.
24819169 2014 SchA-p85-FAK complex dictates isoform-specific activation of Akt2 and subsequent PCBP1-mediated post-transcriptional regulation of TGF?-mediated epithelial to mesenchymal transition in human lung cancer cell line A549.
24489926 2014 PolyC-binding protein 1 interacts with 5'-untranslated region of enterovirus 71 RNA in membrane-associated complex to facilitate viral replication.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23940783 2013 Poly (C)-binding protein 1 regulates p63 expression through mRNA stability.
23640898 2013 Each member of the poly-r(C)-binding protein 1 (PCBP) family exhibits iron chaperone activity toward ferritin.
23629627 2013 ?CP Poly(C) binding proteins act as global regulators of alternative polyadenylation.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23478261 2013 Active stabilization of human endothelial nitric oxide synthase mRNA by hnRNP E1 protects against antisense RNA and microRNAs.
23439585 2013 Altered folate receptor 2 expression in uraemic patients on haemodialysis: implications for folate resistance.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22801034 2012 Down-regulation of poly(rC)-binding protein 1 correlates with the malignant transformation of hydatidiform moles.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22673507 2012 THAP11, a novel binding protein of PCBP1, negatively regulates CD44 alternative splicing and cell invasion in a human hepatoma cell line.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22622828 2012 Possible novel roles of poly(rC)-binding protein 1 in SH-SY5Y neurocytes: an analysis using a dynamic Bayesian network.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22105485 2012 Poly(C)-binding protein 1 (PCBP1) mediates housekeeping degradation of mitochondrial antiviral signaling (MAVS).
22102042 2011 Mutation and crystallization of the first KH domain of human polycytosine-binding protein 1 (PCBP1) in complex with DNA.
22028648 2011 An integrated approach to elucidate the intra-viral and viral-cellular protein interaction networks of a gamma-herpesvirus.
21994455 2011 Generation and comprehensive analysis of an influenza virus polymerase cellular interaction network.
21930702 2011 Incrimination of heterogeneous nuclear ribonucleoprotein E1 (hnRNP-E1) as a candidate sensor of physiological folate deficiency.
21752917 2011 Antagonistic effects of cellular poly(C) binding proteins on vesicular stomatitis virus gene expression.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20609352 2010 PCBP1 suppresses the translation of metastasis-associated PRL-3 phosphatase.
20519371 2010 The poly(c)-binding protein-1 regulates expression of the androgen receptor.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20361869 2010 PCBP-1 regulates alternative splicing of the CD44 gene and inhibits invasion in human hepatoma cell line HepG2 cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19211566 2009 Depletion of the poly(C)-binding proteins alphaCP1 and alphaCP2 from K562 cells leads to p53-independent induction of cyclin-dependent kinase inhibitor (CDKN1A) and G1 arrest.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18656558 2008 Identification of transcripts and translatants targeted by overexpressed PCBP1.
18511687 2008 A cytosolic iron chaperone that delivers iron to ferritin.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17622584 2007 Pre-spliceosomal binding of U1 small nuclear ribonucleoprotein (RNP) and heterogenous nuclear RNP E1 is associated with suppression of a growth hormone receptor pseudoexon.
17389360 2007 Signaling-dependent and coordinated regulation of transcription, splicing, and translation resides in a single coregulator, PCBP1.
17383969 2007 An RNA-binding protein alphaCP-1 is involved in the STAT3-mediated suppression of NF-kappaB transcriptional activity.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16775011 2006 Heterogeneous nuclear ribonucleoprotein (hnRNP) E1 binds to hnRNP A2 and inhibits translation of A2 response element mRNAs.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16510139 2006 Interaction partners for human ZNF384/CIZ/NMP4--zyxin as a mediator for p130CAS signaling?
16341674 2005 Transcriptome analysis of human gastric cancer.
16248985 2005 Novel progerin-interactive partner proteins hnRNP E1, EGF, Mel 18, and UBC9 interact with lamin A/C.
15933215 2005 Poly(C) binding protein family is a transcription factor in mu-opioid receptor gene expression.
15731341 2005 Structure and RNA binding of the third KH domain of poly(C)-binding protein 1.
15635413 2005 Nucleolar proteome dynamics.
15514164 2004 RNA-binding proteins heterogeneous nuclear ribonucleoprotein A1, E1, and K are involved in post-transcriptional control of collagen I and III synthesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456888 2004 The WW domain-containing proteins interact with the early spliceosome and participate in pre-mRNA splicing in vivo.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15246275 2004 A posttranscriptional regulator of Kaposi's sarcoma-associated herpesvirus interacts with RNA-binding protein PCBP1 and controls gene expression through the IRES.
15169918 2004 Bag-1 internal ribosome entry segment activity is promoted by structural changes mediated by poly(rC) binding protein 1 and recruitment of polypyrimidine tract binding protein 1.
14722620 2004 Translational upregulation of folate receptors is mediated by homocysteine via RNA-heterogeneous nuclear ribonucleoprotein E1 interactions.
14612387 2003 A novel set of nuclear localization signals determine distributions of the alphaCP RNA-binding proteins.
12970749 2003 Members of the poly (rC) binding protein family stimulate the activity of the c-myc internal ribosome entry segment in vitro and in vivo.
12933794 2003 HADHB, HuR, and CP1 bind to the distal 3'-untranslated region of human renin mRNA and differentially modulate renin expression.
12890803 2003 Expression of folate receptors and heterogeneous nuclear ribonucleoprotein E1 in women with human papillomavirus mediated transformation of cervical tissue to cancer.
12527772 2003 Polypyrimidine tract binding protein and poly r(C) binding protein 1 interact with the BAG-1 IRES and stimulate its activity in vitro and in vivo.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12431987 2003 The 3'-untranslated region of p21WAF1 mRNA is a composite cis-acting sequence bound by RNA-binding proteins from breast cancer cells, including HuR and poly(C)-binding protein.
12414943 2002 Distinct poly(rC) binding protein KH domain determinants for poliovirus translation initiation and viral RNA replication.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
12011088 2002 Novel binding of HuR and poly(C)-binding protein to a conserved UC-rich motif within the 3'-untranslated region of the androgen receptor messenger RNA.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11591653 2001 Protein-protein interaction panel using mouse full-length cDNAs.
10936052 2000 Identification of two novel mammalian genes establishes a subfamily of KH-domain RNA-binding proteins.
10455157 1999 A set of highly conserved RNA-binding proteins, alphaCP-1 and alphaCP-2, implicated in mRNA stabilization, are coexpressed from an intronless gene and its intron-containing paralog.
10373504 1999 An mRNA stability complex functions with poly(A)-binding protein to stabilize mRNA in vitro.
9234743 1997 Identification of AUF1 (heterogeneous nuclear ribonucleoprotein D) as a component of the alpha-globin mRNA stability complex.
8855318 1996 Poly(rC) binding protein 2 binds to stem-loop IV of the poliovirus RNA 5' noncoding region: identification by automated liquid chromatography-tandem mass spectrometry.
8833161 1996 Assignment of human KH-box-containing genes by in situ hybridization: HNRNPK maps to 9q21.32-q21.33, PCBP1 to 2p12-p13, and PCBP2 to 12q13.12-q13.13, distal to FRA12A.
8152927 1994 Tissue specific expression and cDNA structure of a human transcript encoding a nucleic acid binding [oligo(dC)] protein related to the pre-mRNA binding protein K.
7607214 1995 Characterisation of two major cellular poly(rC)-binding human proteins, each containing three K-homologous (KH) domains.
7556077 1995 Identification of two KH domain proteins in the alpha-globin mRNP stability complex.