Property Summary

NCBI Gene PubMed Count 38
PubMed Score 361.73
PubTator Score 3927.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Acquired immunodeficiency syndrome 197 0.0 0.8

Expression

  Differential Expression (14)

Disease log2 FC p
adrenocortical carcinoma -1.201 4.1e-04
adult high grade glioma -1.100 7.4e-04
atypical teratoid / rhabdoid tumor -1.400 9.4e-05
breast carcinoma -1.400 4.6e-04
ductal carcinoma in situ -2.100 9.4e-04
group 3 medulloblastoma -1.400 7.8e-04
invasive ductal carcinoma -2.200 5.9e-03
lung adenocarcinoma 1.500 1.5e-08
medulloblastoma, large-cell -1.800 7.0e-05
non-small cell lung cancer 1.383 1.8e-12
pancreatic ductal adenocarcinoma liver m... -2.090 3.3e-03
primary Sjogren syndrome -1.100 2.1e-02
primitive neuroectodermal tumor -1.300 6.6e-03
psoriasis 1.500 2.1e-03

 GWAS Trait (1)

Gene RIF (16)

AA Sequence

MLKFRTVHGGLRLLGIRRTSTAPAASPNVRRLEYKPIKKVMVANRGEIAIRVFRACTELGIRTVAIYSEQ      1 - 70
DTGQMHRQKADEAYLIGRGLAPVQAYLHIPDIIKVAKENNVDAVHPGYGFLSERADFAQACQDAGVRFIG     71 - 140
PSPEVVRKMGDKVEARAIAIAAGVPVVPGTDAPITSLHEAHEFSNTYGFPIIFKAAYGGGGRGMRVVHSY    141 - 210
EELEENYTRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDQYGNILHLYERDCSIQRRHQKVVEIAPA    211 - 280
AHLDPQLRTRLTSDSVKLAKQVGYENAGTVEFLVDRHGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIH    281 - 350
VAEGRSLPDLGLRQENIRINGCAIQCRVTTEDPARSFQPDTGRIEVFRSGEGMGIRLDNASAFQGAVISP    351 - 420
HYDSLLVKVIAHGKDHPTAATKMSRALAEFRVRGVKTNIAFLQNVLNNQQFLAGTVDTQFIDENPELFQL    421 - 490
RPAQNRAQKLLHYLGHVMVNGPTTPIPVKASPSPTDPVVPAVPIGPPPAGFRDILLREGPEGFARAVRNH    491 - 560
PGLLLMDTTFRDAHQSLLATRVRTHDLKKIAPYVAHNFSKLFSMENWGGATFDVAMRFLYECPWRRLQEL    561 - 630
RELIPNIPFQMLLRGANAVGYTNYPDNVVFKFCEVAKENGMDVFRVFDSLNYLPNMLLGMEAAGSAGGVV    631 - 700
EAAISYTGDVADPSRTKYSLQYYMGLAEELVRAGTHILCIKDMAGLLKPTACTMLVSSLRDRFPDLPLHI    701 - 770
HTHDTSGAGVAAMLACAQAGADVVDVAADSMSGMTSQPSMGALVACTRGTPLDTEVPMERVFDYSEYWEG    771 - 840
ARGLYAAFDCTATMKSGNSDVYENEIPGGQYTNLHFQAHSMGLGSKFKEVKKAYVEANQMLGDLIKVTPS    841 - 910
SKIVGDLAQFMVQNGLSRAEAEAQAEELSFPRSVVEFLQGYIGVPHGGFPEPFRSKVLKDLPRVEGRPGA    911 - 980
SLPPLDLQALEKELVDRHGEEVTPEDVLSAAMYPDVFAHFKDFTATFGPLDSLNTRLFLQGPKIAEEFEV    981 - 1050
ELERGKTLHIKALAVSDLNRAGQRQVFFELNGQLRSILVKDTQAMKEMHFHPKALKDVKGQIGAPMPGKV   1051 - 1120
IDIKVVAGAKVAKGQPLCVLSAMKMETVVTSPMEGTVRKVHVTKDMTLEGDDLILEIE               1121 - 1178
//

Text Mined References (44)

PMID Year Title