Property Summary

NCBI Gene PubMed Count 25
PubMed Score 8.76
PubTator Score 25.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma, large-cell 6086 1.9e-04
group 3 medulloblastoma 4002 7.2e-04
psoriasis 6514 1.6e-03
Down syndrome 480 2.3e-03
dermatomyositis 941 2.4e-03
osteosarcoma 7766 5.2e-03
lung cancer 4607 6.1e-03
ependymoma 4559 2.6e-02
astrocytoma 1113 4.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.7

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma 1.500 4.5e-02
dermatomyositis -1.100 2.4e-03
Down syndrome 1.100 2.3e-03
ependymoma 1.100 2.6e-02
group 3 medulloblastoma -1.600 7.2e-04
lung cancer -1.200 6.1e-03
medulloblastoma, large-cell -1.300 1.9e-04
osteosarcoma 1.244 5.2e-03
psoriasis 1.300 1.6e-03

Gene RIF (9)

AA Sequence

MASCPDSDNSWVLAGSESLPVETLGPASRMDPESERALQAPHSPSKTDGKELAGTMDGEGTLFQTESPQS      1 - 70
GSILTEETEVKGTLEGDVCGVEPPGPGDTVVQGDLQETTVVTGLGPDTQDLEGQSPPQSLPSTPKAAWIR     71 - 140
EEGRCSSSDDDTDVDMEGLRRRRGREAGPPQPMVPLAVENQAGGEGAGGELGISLNMCLLGALVLLGLGV    141 - 210
LLFSGGLSESETGPMEEVERQVLPDPEVLEAVGDRQDGLREQLQAPVPPDSVPSLQNMGLLLDKLAKENQ    211 - 280
DIRLLQAQLQAQKEELQSLMHQPKGLEEENAQLRGALQQGEAFQRALESELQQLRARLQGLEADCVRGPD    281 - 350
GVCLSGGRGPQGDKAIREQGPREQEPELSFLKQKEQLEAEAQALRQELERQRRLLGSVQQDLERSLQDAS    351 - 420
RGDPAHAGLAELGHRLAQKLQGLENWGQDPGVSANASKAWHQKSHFQNSREWSGKEKWWDGQRDRKAEHW    421 - 490
KHKKEESGRERKKNWGGQEDREPAGRWKEGRPRVEESGSKKEGKRQGPKEPPRKSGSFHSSGEKQKQPRW    491 - 560
REGTKDSHDPLPSWAELLRPKYRAPQGCSGVDECARQEGLTFFGTELAPVRQQELASLLRTYLARLPWAG    561 - 630
QLTKELPLSPAFFGEDGIFRHDRLRFRDFVDALEDSLEEVAVQQTGDDDEVDDFEDFIFSHFFGDKALKK    631 - 700
RSGKKDKHSQSPRAAGPREGHSHSHHHHHRG                                           701 - 731
//

Text Mined References (34)

PMID Year Title