Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.33
PubTator Score 6.26

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
22208664 Sex (male)-specific association of rs16996148 SNP in the NCAN/CILP2/PBX4 and serum lipid levels is observed both the Mulao and Han ethnic groups.
22185299 up-regulation of PREP1 and PBX genes could be implicated in the modulation of the cellular response to chemotherapeutic-induced apoptosis.
20679960 Observational study of gene-disease association. (HuGE Navigator)
18987386 Observational study of gene-disease association. (HuGE Navigator)
18193044 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAPPRPAPSPPAPRRLDTSDVLQQIMAITDQSLDEAQARKHALNCHRMKPALFSVLCEIKEKTVVSIRG      1 - 70
IQDEDPPDAQLLRLDNMLLAEGVCRPEKRGRGGAVARAGTATPGGCPNDNSIEHSDYRAKLSQIRQIYHS     71 - 140
ELEKYEQACREFTTHVTNLLQEQSRMRPVSPKEIERMVGAIHGKFSAIQMQLKQSTCEAVMTLRSRLLDA    141 - 210
RRKRRNFSKQATEVLNEYFYSHLNNPYPSEEAKEELARKGGLTISQVSNWFGNKRIRYKKNMGKFQEEAT    211 - 280
IYTGKTAVDTTEVGVPGNHASCLSTPSSGSSGPFPLPSAGDAFLTLRTLASLQPPPGGGCLQSQAQGSWQ    281 - 350
GATPQPATASPAGDPGSINSSTSN                                                  351 - 374
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22208664 2011 Sex-specific association of rs16996148 SNP in the NCAN/CILP2/PBX4 and serum lipid levels in the Mulao and Han populations.
22185299 2011 MEIS1, PREP1, and PBX4 are differentially expressed in acute lymphoblastic leukemia: association of MEIS1 expression with higher proliferation and chemotherapy resistance.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20679960 2010 Pharmacogenetic analysis of lipid responses to rosuvastatin in Chinese patients.
19060906 2009 Common variants at 30 loci contribute to polygenic dyslipidemia.
18987386 2009 Polymorphisms at newly identified lipid-associated loci are associated with blood lipids and cardiovascular disease in an Asian Malay population.
18193044 2008 Six new loci associated with blood low-density lipoprotein cholesterol, high-density lipoprotein cholesterol or triglycerides in humans.
18033668 2008 PBX proteins: much more than Hox cofactors.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11335119 2001 Pbx4, a new Pbx family member on mouse chromosome 8, is expressed during spermatogenesis.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.