Property Summary

NCBI Gene PubMed Count 19
PubMed Score 9.39
PubTator Score 9.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
nephrosclerosis -1.701 5.8e-03
pancreatic cancer -1.600 2.1e-03
malignant mesothelioma -1.900 2.7e-07
osteosarcoma -1.004 1.2e-02
adrenocortical carcinoma -1.052 1.9e-03
primary pancreatic ductal adenocarcinoma -1.737 1.3e-03
colon cancer -1.700 4.9e-02
pancreatic carcinoma 1.100 2.6e-03
subependymal giant cell astrocytoma 1.965 5.5e-03
progressive supranuclear palsy -1.100 3.5e-02
gastric carcinoma -2.300 4.2e-02
ulcerative colitis -2.700 1.1e-06
pituitary cancer 1.600 9.2e-06

Synonym

Accession P30039 A8MZJ3 C9JIM0 Q9HCC2
Symbols MAWBP
MAWDBP
HEL-S-306

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

PMID Text
26594798 Data show that phenazine biosynthesis-like domain-containing protein (PBLD) is aberrantly downregulated in hepatocellular carcinoma (HCC).
26373288 MAWD and MAWBP were downregulated and associated with the differentiation grade in GC tissues.
23687415 Coexpression of MAWBP and MAWD inhibited epithelial mesenchymal transformation, and EMT-aided malignant cell progression was suppressed in gastric cancer.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFIRKLHPTDNFAQSSCFGLRWF      1 - 70
TPASEVPLCGHATLASAAVLFHKIKNMNSTLTFVTLSGELRARRAEDGIVLDLPLYPAHPQDFHEVEDLI     71 - 140
KTAIGNTLVQDICYSPDTQKLLVRLSDVYNRSFLENLKVNTENLLQVENTGKVKGLILTLKGEPGGQTQA    141 - 210
FDFYSRYFAPWVGVAEDPVTGSAHAVLSSYWSQHLGKKEMHAFQCSHRGGELGISLRPDGRVDIRGGAAV    211 - 280
VLEGTLTA                                                                  281 - 288
//

Text Mined References (23)

PMID Year Title
26594798 2016 Decreased expression of PBLD correlates with poor prognosis and functions as a tumor suppressor in human hepatocellular carcinoma.
26373288 2015 Mitogen-activated protein kinase activator with WD40 repeats (MAWD) and MAWD-binding protein induce cell differentiation in gastric cancer.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23687415 2013 MAWBP and MAWD inhibit proliferation and invasion in gastric cancer.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22068589 2012 Next generation sequencing identifies mutations in Atonal homolog 7 (ATOH7) in families with global eye developmental defects.
20548946 2010 A genome-wide association study of optic disc parameters.
20395239 2010 Genome-wide association identifies ATOH7 as a major gene determining human optic disc size.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17929853 2007 Comparative analysis of the protein profiles from primary gastric tumors and their adjacent regions: MAWBP could be a new protein candidate involved in gastric cancer.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15806103 2005 Maternal segregation of the Dutch preeclampsia locus at 10q22 with a new member of the winged helix gene family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11355021 2001 Cloning and sequencing of a novel human gene which encodes a putative hydroxylase.
1286669 1992 Human liver protein map: a reference database established by microsequencing and gel comparison.