Property Summary

NCBI Gene PubMed Count 19
PubMed Score 9.65
PubTator Score 9.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma -1.052 1.9e-03
colon cancer -1.200 3.2e-02
gastric carcinoma -2.300 4.2e-02
malignant mesothelioma -1.900 2.7e-07
nephrosclerosis -1.701 5.8e-03
osteosarcoma -1.004 1.2e-02
pancreatic cancer 1.100 2.6e-03
pancreatic carcinoma 1.100 2.6e-03
pancreatic ductal adenocarcinoma liver m... -1.253 1.3e-02
pituitary cancer 1.600 9.2e-06
progressive supranuclear palsy -1.100 3.5e-02
subependymal giant cell astrocytoma 1.965 5.5e-03
ulcerative colitis -2.700 1.1e-06

Gene RIF (4)

AA Sequence

MKLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFIRKLHPTDNFAQSSCFGLRWF      1 - 70
TPASEVPLCGHATLASAAVLFHKIKNMNSTLTFVTLSGELRARRAEDGIVLDLPLYPAHPQDFHEVEDLI     71 - 140
KTAIGNTLVQDICYSPDTQKLLVRLSDVYNRSFLENLKVNTENLLQVENTGKVKGLILTLKGEPGGQTQA    141 - 210
FDFYSRYFAPWVGVAEDPVTGSAHAVLSSYWSQHLGKKEMHAFQCSHRGGELGISLRPDGRVDIRGGAAV    211 - 280
VLEGTLTA                                                                  281 - 288
//

Text Mined References (23)

PMID Year Title