Property Summary

NCBI Gene PubMed Count 44
PubMed Score 252.40
PubTator Score 107.75

Knowledge Summary

Patent (57,704)

Expression

  Differential Expression (30)

Disease log2 FC p
psoriasis 2.300 7.7e-05
astrocytoma 1.600 7.7e-07
glioblastoma 4.800 9.6e-14
oligodendroglioma 2.000 2.5e-07
posterior fossa group A ependymoma 3.100 1.7e-06
group 3 medulloblastoma 5.300 6.2e-10
atypical teratoid/rhabdoid tumor 4.200 4.0e-13
medulloblastoma, large-cell 5.100 6.4e-09
primitive neuroectodermal tumor 4.800 3.3e-07
Atopic dermatitis 1.300 2.0e-03
adrenocortical carcinoma 4.206 1.3e-06
non-small cell lung cancer 3.495 5.0e-29
intraductal papillary-mucinous carcinoma... 3.100 8.4e-04
intraductal papillary-mucinous neoplasm ... 3.900 1.0e-03
lung cancer 4.500 1.2e-07
pancreatic cancer 1.600 2.0e-04
breast carcinoma 1.800 4.6e-06
interstitial cystitis 1.200 4.6e-03
lung adenocarcinoma 1.500 6.0e-05
pediatric high grade glioma 4.700 9.3e-10
pilocytic astrocytoma 1.900 4.8e-05
primary Sjogren syndrome 1.100 3.0e-02
nasopharyngeal carcinoma 2.200 9.5e-05
Endometriosis 2.458 1.1e-02
Breast cancer 2.700 1.5e-14
ductal carcinoma in situ 2.700 1.5e-03
invasive ductal carcinoma 3.900 1.0e-04
ulcerative colitis 1.400 3.3e-04
ovarian cancer 1.700 4.0e-03
pituitary cancer 1.200 8.0e-03

Gene RIF (31)

PMID Text
26503118 Overexpression of Nrf2 inhibited the PBK/TOPK KD-induced decrease in cdc2 and cyclin B expression and cell cycle arrest, and blocked ROS production and apoptosis.
25909225 The in vitro data have been consistent with a role for PBK/TOPK in facilitating invasion in prostate cancer. PBK could be a prognostic biomarker for prostate cancer that would discriminate aggressive prostate cancer from indolent disease.
25881543 TOPK was speculated to be one of a potential marker and therapeutic target in advanced prostate cancer
25687885 TOPK, overexpressed in colorectal cancer, enhances the resistance of colorectal cancer cells to anoikis.
25575812 Authors identified TOPK/PBK, in vitro and in vivo, as the master ZFP linker kinase. Furthermore, they show precise temporal correlation between TOPK activating phosphorylation by Cdk1 and linker phosphorylation in mitosis.
25550851 PBK/TOPK expression is closely associated with cervical cancer and cervical intraepithelial neoplasia, which may be served as a useful target for tumor diagnosis and immunotherapy.
25466965 PDZ-binding kinase/T-LAK cell-originated protein kinase correlates with mutant p53 and affects cell proliferation and viability as well as prognosis in lung adenocarcinoma
24629784 Study findings suggest that the PBK/TOPK mRNA/protein expression is specific to human bladder cancer and might be used as a novel target for development of cancer immunotherapy and diagnostic biomarker.
24440499 TOPK protein upregulates iNOS gene expression in T cell leukemia Jurkat cells or macrophage leukemic Raw 264.7 cells via NF-kappaB activation in response to LPS, and might act as a critical effector in LPS/TLR4-mediated signaling cascade.
24025073 PBK/TOPK expression is positively correlated with Ki67 and p53 expression, and can be used as an independent prognostic factor in non-small-cell lung cancer.
24012691 CHFR ubiquitinates and regulates TOPK levels, which is essential for its checkpoint function.
23547718 Antibody screening revealed 3 candidate prognostic markers in breast cancer: the Anillin (ANLN); PDZ-Binding Kinase (PBK); and, PDZ-Domain Containing 1 (PDZK1).
23370767 These results suggest that the malignant transformation of plexiform neurofibroma is associated with distinct changes in the expression of BUB1B, PBK and NEK2
23250755 TOPK directly interacted with and phosphorylated IkappaBalpha at Ser-32, leading to p65 nuclear translocation and NF-kappaB activation.
23237560 that the serine-threonine kinase PBK/TOPK is frequently overexpressed in high-grade lymphomas and its expression is positively correlated to that of c-Myc and E2F1
22940854 The 3D structure of TOPK protein has been constructed by using multiple templates.
22192142 Our results indicate that overexpression of TOPK could predetermine the metastatic capability of tumors and could serve as a significant prognostic predictor of shortened overall survival and time to recurrence.
21715333 T-LAK cell-originated protein kinase (TOPK) phosphorylation of MKP1 protein prevents solar ultraviolet light-induced inflammation through inhibition of the p38 protein signaling pathway.
20647304 Phosphorylation of Prx1 (Ser-32) by TOPK prevents UVB-induced apoptosis in RPMI7951 melanoma cells through regulation of Prx1 peroxidase activity and blockade of intracellular H(2)O(2) accumulation.
20622899 increased levels of PBK/TOPK may contribute to tumor cell development and progression through suppression of p53 function and consequent reductions in the cell-cycle regulatory proteins such as p21.
20589935 Upregulation of TOPK is associated with breast cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19954816 PBK/TOPK protein could serve as a useful indicator for histopathologic differentiation between cholangiocarcinoma and hepatocellular carcinomas and the low expression of PBK/TOPK is predicative of poor survival in cholangiocarcinoma patients.
19900192 TOPK is indispensable for cancer cell cytokinesis throughout phosphorylation on p97.
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17631144 The positive feedback loop between TOPK and ERK2 increases tumorigenesis properties of HCT116 colorectal cancer cells, and TOPK-regulated signaling may serve as a potential therapeutic target in colorectal cancer
17545598 Findings showed that TOPK positively modulated UVB-induced JNK1 activity and played a pivotal role in JNK1-mediated cell transformation induced by H-Ras.
17482142 PBK augments tumor cell growth following transient appearance in different types of progenitor cells in vivo as reported.
16291951 PBK/TOPK plays an important role in transiently amplifying neural progenitors in the adult subependymal zone of transgenically targeted mice.
14757441 TOPK protein is up-regulated in a variety of hematologic malignancies and may be involved in leukemic cell growth; 4 of 5 clinical that strongly expressed TOPK also strongly expressed phosphorylated c-Myc
11783945 PBK/TOPK is upregulated in Burkitt's lymphoma and other highly proliferative malignant cells and during normal fetal development.

AA Sequence

MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPIC      1 - 70
NDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPA     71 - 140
AIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTE    141 - 210
PWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPP    211 - 280
INMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV                                281 - 322
//

Text Mined References (53)

PMID Year Title
26503118 2015 PBK/TOPK mediates promyelocyte proliferation via Nrf2-regulated cell cycle progression and apoptosis.
25909225 2015 PBK/TOPK enhances aggressive phenotype in prostate cancer via ?-catenin-TCF/LEF-mediated matrix metalloproteinases production and invasion.
25881543 2015 TOPK is highly expressed in circulating tumor cells, enabling metastasis of prostate cancer.
25687885 2015 CXCL8, overexpressed in colorectal cancer, enhances the resistance of colorectal cancer cells to anoikis.
25575812 2015 Identification of the oncogenic kinase TOPK/PBK as a master mitotic regulator of C2H2 zinc finger proteins.
25550851 2014 Expression of PBK/TOPK in cervical cancer and cervical intraepithelial neoplasia.
25466965 2015 PBK/TOPK expression correlates with mutant p53 and affects patients' prognosis and cell proliferation and viability in lung adenocarcinoma.
24629784 2014 Expression of PDZ-binding kinase/T-LAK cell-originated protein kinase (PBK/TOPK) in human urinary bladder transitional cell carcinoma.
24440499 2014 Activation of TOPK by lipopolysaccharide promotes induction of inducible nitric oxide synthase through NF-?B activity in leukemia cells.
24025073 2013 PBK/TOPK expression in non-small-cell lung cancer: its correlation and prognostic significance with Ki67 and p53 expression.
24012691 2013 TOPK and PTEN participate in CHFR mediated mitotic checkpoint.
23547718 2013 Systematic antibody generation and validation via tissue microarray technology leading to identification of a novel protein prognostic panel in breast cancer.
23370767 2013 Expression profiling of 519 kinase genes in matched malignant peripheral nerve sheath tumor/plexiform neurofibroma samples is discriminatory and identifies mitotic regulators BUB1B, PBK and NEK2 as overexpressed with transformation.
23250755 2013 Phosphorylation of I?B? at serine 32 by T-lymphokine-activated killer cell-originated protein kinase is essential for chemoresistance against doxorubicin in cervical cancer cells.
23237560 2013 c-Myc and E2F1 drive PBK/TOPK expression in high-grade malignant lymphomas.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22940854 2013 In silico structural and functional analysis of the human TOPK protein by structure modeling and molecular dynamics studies.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22192142 2012 Overexpression of T-LAK cell-originated protein kinase predicts poor prognosis in patients with stage I lung adenocarcinoma.
21715333 2011 T-LAK cell-originated protein kinase (TOPK) phosphorylation of MKP1 protein prevents solar ultraviolet light-induced inflammation through inhibition of the p38 protein signaling pathway.
21269460 2011 Initial characterization of the human central proteome.
20647304 2010 T-LAK cell-originated protein kinase (TOPK) phosphorylation of Prx1 at Ser-32 prevents UVB-induced apoptosis in RPMI7951 melanoma cells through the regulation of Prx1 peroxidase activity.
20622899 2010 PBK/TOPK interacts with the DBD domain of tumor suppressor p53 and modulates expression of transcriptional targets including p21.
20589935 2010 Critical roles of LGN/GPSM2 phosphorylation by PBK/TOPK in cell division of breast cancer cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19954816 2010 PBK/TOPK in the differential diagnosis of cholangiocarcinoma from hepatocellular carcinoma and its involvement in prognosis of human cholangiocarcinoma.
19900192 2010 Critical roles of T-LAK cell-originated protein kinase in cytokinesis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17631144 2007 Bidirectional signals transduced by TOPK-ERK interaction increase tumorigenesis of HCT116 colorectal cancer cells.
17545598 2007 T-lymphokine-activated killer cell-originated protein kinase functions as a positive regulator of c-Jun-NH2-kinase 1 signaling and H-Ras-induced cell transformation.
17482142 2007 Attenuation of DNA damage checkpoint by PBK, a novel mitotic kinase, involves protein-protein interaction with tumor suppressor p53.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16291951 2005 PBK/TOPK, a proliferating neural progenitor-specific mitogen-activated protein kinase kinase.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15541388 2004 Characterization of a MAPKK-like protein kinase TOPK.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14757441 Protein expression of PDZ-binding kinase is up-regulated in hematologic malignancies and strongly down-regulated during terminal differentiation of HL-60 leukemic cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12620389 2003 Novel raf kinase protein-protein interactions found by an exhaustive yeast two-hybrid analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11783945 PBK/TOPK is a novel mitotic kinase which is upregulated in Burkitt's lymphoma and other highly proliferative malignant cells.
11378444 2001 PDZ-binding kinase participates in spermatogenesis.
10781613 2000 Cloning and expression of a novel MAPKK-like protein kinase, lymphokine-activated killer T-cell-originated protein kinase, specifically expressed in the testis and activated lymphoid cells.
10779557 2000 Characterization of PDZ-binding kinase, a mitotic kinase.