Property Summary

Ligand Count 4
NCBI Gene PubMed Count 56
PubMed Score 272.56
PubTator Score 107.75

Knowledge Summary

Patent (57,704)

Expression

  Differential Expression (30)

Disease log2 FC p
adrenocortical carcinoma 4.206 1.3e-06
adult high grade glioma 3.400 1.7e-05
astrocytoma 1.600 7.7e-07
Astrocytoma, Pilocytic 1.900 5.2e-05
Atopic dermatitis 1.300 2.0e-03
atypical teratoid / rhabdoid tumor 4.000 4.0e-10
Breast cancer 2.700 1.5e-14
breast carcinoma 1.800 4.6e-06
ductal carcinoma in situ 2.700 1.5e-03
Endometriosis 2.458 1.1e-02
ependymoma 2.800 1.4e-06
glioblastoma 4.800 9.6e-14
group 3 medulloblastoma 5.300 6.2e-10
interstitial cystitis 1.200 4.6e-03
intraductal papillary-mucinous carcinoma... 3.100 8.4e-04
intraductal papillary-mucinous neoplasm ... 3.900 1.0e-03
invasive ductal carcinoma 3.900 1.0e-04
lung adenocarcinoma 1.100 7.9e-06
lung cancer 2.500 7.8e-05
medulloblastoma, large-cell 5.100 6.4e-09
nasopharyngeal carcinoma 2.200 9.5e-05
non-small cell lung cancer 3.495 5.0e-29
oligodendroglioma 2.000 2.5e-07
ovarian cancer 1.700 4.0e-03
pancreatic cancer 1.600 2.0e-04
pituitary cancer 1.200 8.0e-03
primary Sjogren syndrome 1.100 3.0e-02
primitive neuroectodermal tumor 4.800 3.3e-07
psoriasis 1.200 6.1e-05
ulcerative colitis 1.400 3.3e-04

Gene RIF (43)

AA Sequence

MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPIC      1 - 70
NDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPA     71 - 140
AIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTE    141 - 210
PWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPP    211 - 280
INMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV                                281 - 322
//

Text Mined References (66)

PMID Year Title