Property Summary

NCBI Gene PubMed Count 139
PubMed Score 471.78
PubTator Score 322.16

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (103)

PMID Text
27324546 PAX2 gene silencing can significantly inhibit the process of epithelial-mesenchymal transition (EMT) of renal tubular cells in rats with advanced fibrosis.
26823795 PAX2 and PAX5 are useful biomarker in the differential diagnosis of lung cancer
26571382 The results of this study identify several new mutations of PAX2, and sequence variants in four additional genes, including a novel potentially pathogenic mutation in KIF26B, which may play a role in the pathogenesis of Renal Coloboma Syndrome.
26404914 a substantial minority of solitary fibrous tumors express nuclear PAX8 and PAX2
25912758 Report increased Pax2 expression in the ureter epithelium of children with vesicoureteric reflux.
25854853 Homozygosity for the risk alleles of RET and PAX2 was not seen in the late onset group in primary hyperoxaluria type 1 patients.
25631048 PPM1B interacts with Groucho 4 and is localized to DNA in a Groucho-dependent manner, and phosphatase activity is required for transcriptional silencing.
25613757 Results showed that PAX2 expression is significantly overexpressed in esophageal squamous cell carcinoma tissues and IL-5 is identified as PAX2's effector for metastasis.
25500505 data suggested the differential regulation of hDAO expression by two promoters whose activities may be modulated by the binding of PAX2 and PAX5
25385517 The 798C>T/909A>C PAX2 genotype did not increase the susceptibility to HenochSchonlein purpura (HSP), but it was likely to increase the susceptibility of kidney involvement in HSP patients.
25279712 Immunohistochemical distinction of renal cell carcinoma from other carcinomas with clear-cell histomorphology: utility of CD10 and CA-125 in addition to PAX-2, PAX-8, RCCma, and adipophilin.
25180270 Novel PAX2 targets included multiple genes encoding proteins with predicted functions in the epididymis epithelium.
25132193 PAX2 promotes cancer cell growth in androgen-independent prostate cancer by regulating androgen receptor gene expression through an epigenetic mechanism.
25130537 study, for the first time, links PAX2-null with proliferating fetal and adult oviductal cells undergoing basal and ciliated differentiation and shows that this expression state is maintained in high-grade serous cancer precursors
25106525 Pax2 may play a role in kidney development by regulating the expression of TBX1.
24992169 PAX2 and PAX8 are useful biomarker in the differential diagnosis of ovarian serous and mucinous tumors
24897005 PAX2 was strongly positive in all alveolar rhabdomyosarcomas and in two-thirds of the kidney clear cell sarcomas, and displayed variable expression in one-half of the embryonal rhabdomyosarcomas.
24676634 Exome sequencing in an index family with dominant FSGS revealed a nonconservative, disease-segregating variant in the PAX2 gene. Sequencing in probands of a familial FSGS cohort revealed seven rare and private heterozygous SNPs (4% of individuals).
24633556 study suggests an association between PAX2 gene polymorphisms and the development of vesicoureteral reflux, but not with ureteropelvic junction obstruction and multicystic dysplastic kidney
24344503 These data suggest that in difficult diagnostic cases both PAX2 and mesothelin immunohistochemical study may be useful in discriminating between PMRCC and primary pancreatic carcinoma.
24334997 PAX2 and PAX8 are valuable diagnostic markers for metastatic mullerian carcinomas and renal cell carcinoma in effusion cytology
24141260 cotransfection of Pax2 and Math1 strongly stimulates in situ hair cell regeneration in neomycin-damaged cochlear explants.
24040464 Case Report: sporadic renal hemangioblastoma expressing PAX2.
23890189 Pax-2 expression might be used as an ancillary tool to discriminate chromophobe renal cell tumour from oncocytomas with overlapping morphological features.
23861881 miR-1915 and miR-1225-5p regulated the expression of important markers of renal progenitors, such as CD133 and PAX2, and important genes involved in the repair mechanisms of adult renal progenitor cells, such as TLR2.
23765687 Our data suggested that PAX2 hyper-expression promotes the development of the metastatic state in prostate cancer cells, presumably through upregulating the expression of cell membrane proteins.
23756089 other genes and/or locus control regions regulating PAX2 may be involved in the pathogenesis of PAX2 mutation-negative cases of RCS.
23686327 Cryptorchidism-associated papillorenal syndrome/PAX2 mutation has not been reported.
23539225 Report high rate of mutations in PAX2 genes known to be involved in monogenic syndromic Congenital anomalies of the kidney and urinary tract.
23503645 PAX2 and napsin A have high specificity but low sensitivity and only have limited value in the differential diagnosis of mesotheliomas and renal cell carcinomas
23328975 Immunostains for PAX2 and PAX8 are useful in the detection of nephrogenic adenomas and particularly unveil those nephrogenic adenomas with flat pattern.
23202787 PAX2 is effective in discriminating cervical adenocarcinoma in situ from benign endocervical glandular epithelium
23196794 PAX2 has little practical value in the diagnosis of peritoneal epithelioid mesotheliomas
23194047 investigation of expression of PAX2 and PAX8 in renal biopsy samples as diagnostic markers in the differential diagnosis of various types of primary and secondary renal cell carcinomas
23137159 PAX2 gene is pivotal in kidney development and it is implicated in the pathogenesis of renal interstitial fibrosis (RIF) and glomerulosclerosis (GS).
23135283 PAX2 protein induces expression of cyclin D1 through activating AP-1 protein and promotes proliferation of colon cancer cells.
22984579 cross-talk between p53 and Pax2 provides a transcriptional platform that promotes nephrogenesis, thus contributing to nephron endowment
22807381 PAX8 and PAX2 are diagnostically useful adjuncts in confirming the diagnosis of renal cell carcinoma in cytology specimens.
22727345 No association was found between Pax-2 expression and disease persistance/progression in endometrial hyperplasia treated with progestins.
22683154 Mutations in PAX2 may not be ac ommon cause of Mullerian Duct Abnormalities.
22660956 In both monozygotic twins with renal coloboma syndrome, a novel de novo mutation of PAX2 was detected, which leads to the substitution of a highly conserved cysteine (p.C52Y).
22552444 PAX2 expression was detected in the majority of medulloblastoma samples and correlated with less differentiated histology
22495365 PAX-2, PAX-8, and hKIM-1 should be used cautiously in distinguishing renal cell carcinoma from nonseminomatous germ cell neoplasia and also adds to the growing list of nonrenal tumors that express these 3 markers.
22473392 in endometriosis patients, paired box protein Pax2 is down-regulated in the lesions compared with the eutopic tissue, possibly due to low epidermal growth factor (EGF) signalling
22274645 These findings suggest that PAX2 may play a role in endometrial carcinogenesis.
22213154 update of PAX2 mutations in renal coloboma syndrome; review of published cases and the collective diagnostic experience of 3 laboratories in the United States, France and New Zealand identified 55 unique mutations in 173 individuals from 86 families; a locus-specific database was created
22169637 The high-grade serous carcinomas had a significantly higher expression level of p53 and Ki-67, while low-grade carcinomas had a significantly higher expression level of Pax2.
22138676 This review outlines the current evidence supporting involvement of PAX2 in the pathologic processes involving the kidney.[review]
22080059 We propose a unique co-variable in benign oviductal epithelium-the PAX2-null SCOUT-that reflects underlying dysregulation in genes linked to serous neoplasia.
21989345 PAX8 supersedes PAX2 as probably the best epithelial marker hitherto for primary or metastatic mullerian epithelial tumors.
21934480 PAX8 and PAX2 IHC may facilitate the diagnosis of primary epithelial neoplasms of the male genital tract.
21876729 PAX2 can regulate ADAM10 expression, a metalloproteinase known to play important roles in melanoma metastasis.
21836481 Diffuse expression of PAX2 and PAX8 in the cystic epithelium of mixed epithelial stromal tumor, angiomyolipoma with epithelial cysts, and primary renal synovial sarcoma supports renal tubular differentiation.
21730820 PAX2 is a sensitive marker of Wilm's tumor, but antibody shows weak-to-moderate-intensity nuclear staining of rhabdomyosarcoma and B-cell acute lymphoblastic lymphoma.
21696512 The renal phenotypic feature of PRS is known to have a wide variation from only mild proteinuria without renal dysfunction to end-stage renal disease (ESRD) at school age to adulthood, even in patients with the same PAX2 gene mutations.
21575608 these results suggest that PHD3 targets Pax2 for destruction.
21380624 Mutations in HNF1Beta and PAX2 commonly cause syndromic urinary tract malformation.
21263247 The PAX2(-), PAX8(-), and inhibin A(+) profile supports the diagnosis of hemangioblastoma with a sensitivity of 95%, specificity of 100%, and positive predictive value of 100%.
21108633 PAX2 mutations may be associated with isolated renal hypoplasia.
20670131 PAX-2 is a sensitive and specific marker for metastatic renal cell carcinoma.
20631067 PAX2 and PTEN protein loss occurs independently and accumulates with increasing age in latent precancers of normal premenopausal endometrium. Loss of both characterizes the emergence of a premalignant lesion which carries forward to carcinoma.
20413145 PAX-2 is expressed by immunohistochemistry in seminal vesicles and the ejaculatory ducts, but not in prostatic adenocarcinoma.
20358591 report on two fetuses with fetal renal hypodysplasia with PAX2 mutations; identified a de novo single G deletion of nucleotide 935 in exon 3 of the PAX2 resulting in a frameshift mutation
20061933 PAX2 distinguishes benign mesonephric and mullerian glandular lesions of the cervix from endocervical adenocarcinoma, including minimal deviation adenocarcinoma.
19959718 Observational study of gene-disease association. (HuGE Navigator)
19851209 PAX 2 is a promising new, sensitive, and specific mullerian immunomarker for ovarian serous carcinomas (primary and metastatic)
19556301 Renal recovery after injury: the role of Pax-2. Review.
19525924 a statistically significant difference in PAX2 mRNA expression among ovarian tumors of low malignant potential, low-grade, and high-grade carcinoma samples
19517575 PAX2 may be a novel therapeutic target for the treatment of carcinomas such as prostate cancer via the down-regulation of its expression by targeting the AT1R signaling pathways.
19467152 A previously undescribed intron 9 and exon 10 containing splice variant of PAX2 in B-cell neoplasia and in solid tumors on mRNA and protein level, is described.
19401348 Study concluded that in ccRCC, PAX2 reactivation is driven by HIF-dependent mechanisms following pVHL loss.
19228645 PAX-2 seems to have a significant role in renal neogenesis and may represent a novel therapeutic target.
19118900 PAX2 oncogene suppresses hBD1 expression in cancer and further implicate PAX2 as a novel therapeutic target for prostate cancer treatment.
19048125 WNT5A is regulated by PAX2 and may be involved in blastemal predominant Wilms tumorigenesis
18941400 potential diagnostic utility of Pax 2 in distinction of (i) oncocytoma from chromophobe RCC, (ii) clear cell RCC and papillary RCC from renal tumors with Xp11.2 translocation and (iii) high-grade clear cell RCC from urothelial carcinoma
18685487 Conclude that PAX-2 is a useful marker for distinguishing metastatic clear cell renal carcinoma from its potential morphologic mimics.
18609495 The association of optic nerve and renal malformations should lead to the suspicion of papillorenal syndrome with PAX2 mutation.
18439754 PAX2 is a potential therapeutic gene target in renal cancer and suggest that adjunctive PAX2 knockdown may enhance the efficacy of other chemotherapeutic agents.
18379529 familial renal failure with ocular abnormality
18056486 Herpesvirus 8, Human infection may activate an embryonic angiogenic program in human microvascular endothelial cells by inducing the expression of PAX2 oncogene.
17529925 PAX2 was identified in ovarian papillary serous carcinoma cells derived from Mullerian epithelium or surrounding ovary.
17513325 Observational study of gene-disease association. (HuGE Navigator)
17513325 Subtle renal hypoplasia in normal newborns may be partially due to a common variant of the PAX2 gene that reduces mRNA expression during kidney development
17269592 Renal-coloboma syndrome: a single nucleotide deletion in the PAX2 gene at Exon 8 is associated with a highly variable phenotype
16971658 Mutations in PAX2 is associated with renal hypodysplasia
16814811 Results showed no direct involvement of PAX-8 genes in Wilms tumor pathogenesis.
16735463 Powerful effects of PAX2 on renal branching morphogenesis and final nephron number may be mediated by activation of Naip which then suppresses apoptosis in ureter bud cells.
16609680 Pax2 overexpression in renal cell carcinoma cells contributes to cisplatin resistance.
16509931 Observational study of gene-disease association. (HuGE Navigator)
16436683 Over expression of Pax2 is associated with apoptosis resistance and angiogenesis favoring renal tumor growth
16400326 PAX2 is a specific and sensitive immunohistochemical marker in identification and differential diagnosis of nephrogenic adenoma.
16385451 Observational study of gene-disease association. (HuGE Navigator)
15808183 Molecular genetic analysis of the PAX2 gene in combination with renal ultrasonography can help in making an earlier diagnosis of the disease.
15652857 A new PAX2 missense mutation, R71T, may cause macular abnormalities in addition to anomalies of the optic disk and the kidney.
15502805 PAX-2 is a reliable marker for clear cell renal cell carcinomas of lower grades but not for higher grades.
14627715 expression of Pax2 by Kaposi's sarcoma cells correlated with an enhanced resistance against apoptotic signals and with the proinvasive phenotype
14566649 PAX2 mutation is associated with Optic nerve dysplasia and renal insufficiency of the renal-coloboma syndrome
14561758 Pax2 protein regulates expression of secreted frizzled related protein 2
12970747 The PAX2 gene was frequently expressed in a panel of 406 common primary tumor tissues and endogenous PAX gene expression is often required for the growth and survival of cancer cells
12141441 PAX2 has a role in urogenital tract development and disease [review]
11940591 The HMG-I/Y-related protein p8 binds to p300 and Pax2 trans-activation domain-interacting protein to regulate the trans-activation activity of the Pax2A and Pax2B transcription factors on the glucagon gene promoter.
11826030 The absence of PAX2 mutations has been identified in two families with histories of clinical overlap of Okihiro and acro-renal-ocular syndromes.
11730657 The causal relationship between PAX2 gene mutations and renal-coloboma syndrome is further supported

AA Sequence

MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILG      1 - 70
RYYETGSIKPGVIGGSKPKVATPKVVDKIAEYKRQNPTMFAWEIRDRLLAEGICDNDTVPSVSSINRIIR     71 - 140
TKVQQPFHPTPDGAGTGVTAPGHTIVPSTASPPVSSASNDPVGSYSINGILGIPRSNGEKRKRDEVEVYT    141 - 210
DPAHIRGGGGLHLVWTLRDVSEGSVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQAS    211 - 280
EHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYPVVTGRDMASTTLPGYPPHVPPTGQ    281 - 350
GSYPTSTLAGMVPGSEFSGNPYSHPQYTAYNEAWRFSNPALLSSPYYYSAAPRGSAPAAAAAAYDRH       351 - 417
//

Text Mined References (141)

PMID Year Title
27324546 2016 [Influence of PAX2 gene silencing on renal interstitial fibrosis in rats].
26823795 2015 Diagnostic utility of PAX2 and PAX5 in distinguishing non-small cell lung cancer from small cell lung cancer.
26571382 2015 Association of PAX2 and Other Gene Mutations with the Clinical Manifestations of Renal Coloboma Syndrome.
26404914 2016 A subset of solitary fibrous tumors express nuclear PAX8 and PAX2: a potential diagnostic pitfall.
25912758 2015 The significance of Pax2 expression in the ureter epithelium of children with vesicoureteric reflux.
25854853 2015 SNP Variants in RET and PAX2 and Their Possible Contribution to the Primary Hyperoxaluria Type 1 Phenotype.
25631048 2015 The Groucho-associated phosphatase PPM1B displaces Pax transactivation domain interacting protein (PTIP) to switch the transcription factor Pax2 from a transcriptional activator to a repressor.
25613757 2015 Upregulation of PAX2 promotes the metastasis of esophageal cancer through interleukin-5.
25500505 2015 Identification of two promoters for human D-amino acid oxidase gene: implication for the differential promoter regulation mediated by PAX5/PAX2.
25385517 2015 Association of the paired box 2 gene polymorphism with the susceptibility and pathogenesis of Henoch?Schönlein purpura in children.
25279712 2014 Immunohistochemical distinction of renal cell carcinoma from other carcinomas with clear-cell histomorphology: utility of CD10 and CA-125 in addition to PAX-2, PAX-8, RCCma, and adipophilin.
25180270 2014 Open chromatin mapping identifies transcriptional networks regulating human epididymis epithelial function.
25132193 2014 Paired box 2 upregulates androgen receptor gene expression in androgen-independent prostate cancer.
25130537 2014 The PAX2-null immunophenotype defines multiple lineages with common expression signatures in benign and neoplastic oviductal epithelium.
25106525 2014 Pax2 may play a role in kidney development by regulating the expression of TBX1.
24992169 2015 PAX2 and PAX8 reliably distinguishes ovarian serous tumors from mucinous tumors.
24897005 2014 PAX immunoreactivity in poorly differentiated small round cell tumors of childhood.
24676634 2014 Mutations in PAX2 associate with adult-onset FSGS.
24633556 2014 PAX2 polymorphisms and congenital abnormalities of the kidney and urinary tract in a Brazilian pediatric population: evidence for a role in vesicoureteral reflux.
24344503 2013 Pancreatic metastases of renal clear cell carcinoma: a clinicopathological study of 11 cases with special emphasis on the usefulness of PAX2 and mesothelin for the distinction from primary ductal adenocarcinoma of the pancreas.
24334997 2014 PAX2 and PAX8: useful markers for metastatic effusions.
24141260 2013 Cotransfection of Pax2 and Math1 promote in situ cochlear hair cell regeneration after neomycin insult.
24040464 2013 Sporadic hemangioblastoma of the kidney with PAX2 and focal CD10 expression: report of a case.
23890189 2013 Deregulation of PAX2 expression in renal cell tumours: mechanisms and potential use in differential diagnosis.
23861881 2013 miR-1915 and miR-1225-5p regulate the expression of CD133, PAX2 and TLR2 in adult renal progenitor cells.
23765687 2013 Hyper-expression of PAX2 in human metastatic prostate tumors and its role as a cancer promoter in an in vitro invasion model.
23756089 2013 Detection of PAX2 deletions and duplications using multiplex ligation-dependent probe amplification.
23686327 2013 Papillorenal syndrome in a family with unusual complications.
23539225 2013 Severe prenatal renal anomalies associated with mutations in HNF1B or PAX2 genes.
23503645 2013 Value of PAX8, PAX2, napsin A, carbonic anhydrase IX, and claudin-4 immunostaining in distinguishing pleural epithelioid mesothelioma from metastatic renal cell carcinoma.
23328975 2013 Flat pattern of nephrogenic adenoma: previously unrecognized pattern unveiled using PAX2 and PAX8 immunohistochemistry.
23202787 2013 PAX8 and PAX2 expression in endocervical adenocarcinoma in situ and high-grade squamous dysplasia.
23196794 2013 Value of PAX8, PAX2, claudin-4, and h-caldesmon immunostaining in distinguishing peritoneal epithelioid mesotheliomas from serous carcinomas.
23194047 2012 PAX2 and PAX8 expression in primary and metastatic renal tumors: a comprehensive comparison.
23137159 2012 Signaling pathways of PAX2 and its role in renal interstitial fibrosis and glomerulosclerosis.
23135283 2012 PAX2 protein induces expression of cyclin D1 through activating AP-1 protein and promotes proliferation of colon cancer cells.
22984579 2012 A p53-Pax2 pathway in kidney development: implications for nephrogenesis.
22807381 2012 Utility of PAX8 and PAX2 immunohistochemistry in the identification of renal cell carcinoma in diagnostic cytology.
22727345 2012 Biomarkers of progestin therapy resistance and endometrial hyperplasia progression.
22683154 2012 PAX2 in 192 Chinese women with Müllerian duct abnormalities: mutation analysis.
22660956 2012 Discordant phenotype in monozygotic twins with renal coloboma syndrome and a PAX2 mutation.
22552444 2012 PAX2 is an antiapoptotic molecule with deregulated expression in medulloblastoma.
22495365 2012 Evaluation of putative renal cell carcinoma markers PAX-2, PAX-8, and hKIM-1 in germ cell tumors: a tissue microarray study of 100 cases.
22473392 2012 Paired-box gene 2 is down-regulated in endometriosis and correlates with low epidermal growth factor receptor expression.
22274645 2012 Expression pattern of PAX2 in hyperplastic and malignant endometrium.
22213154 2012 Update of PAX2 mutations in renal coloboma syndrome and establishment of a locus-specific database.
22169637 2011 [Clinicopathologic study and immunohistochemistry comparison of Pax2, p53 and Ki-67 in low- and high-grade ovarian serous carcinomas].
22138676 2012 PAX2 in human kidney malformations and disease.
22080059 2012 PAX2-null secretory cell outgrowths in the oviduct and their relationship to pelvic serous cancer.
21989345 2011 PAX2 and PAX8 expression in primary and metastatic müllerian epithelial tumors: a comprehensive comparison.
21934480 2011 PAX8 and PAX2 immunostaining facilitates the diagnosis of primary epithelial neoplasms of the male genital tract.
21876729 2011 PAX2 regulates ADAM10 expression and mediates anchorage-independent cell growth of melanoma cells.
21836481 2011 Diffuse expression of PAX2 and PAX8 in the cystic epithelium of mixed epithelial stromal tumor, angiomyolipoma with epithelial cysts, and primary renal synovial sarcoma: evidence supporting renal tubular differentiation.
21730820 2011 PAX2 expression in Wilms tumors and other childhood neoplasms.
21696512 2011 A surviving case of papillorenal syndrome with the phenotype of Potter sequence.
21575608 2011 Prolyl hydroxylase domain protein 3 targets Pax2 for destruction.
21380624 2011 HNF1B and PAX2 mutations are a common cause of renal hypodysplasia in the CKiD cohort.
21263247 2011 PAX2(-)/PAX8(-)/inhibin A(+) immunoprofile in hemangioblastoma: A helpful combination in the differential diagnosis with metastatic clear cell renal cell carcinoma to the central nervous system.
21108633 2011 PAX2 gene mutations in pediatric and young adult transplant recipients: kidney and urinary tract malformations without ocular anomalies.
20670131 2010 PAX-2 is a helpful marker for diagnosing metastatic renal cell carcinoma: comparison with the renal cell carcinoma marker antigen and kidney-specific cadherin.
20631067 2010 Joint loss of PAX2 and PTEN expression in endometrial precancers and cancer.
20413145 2010 The distribution of PAX-2 immunoreactivity in the prostate gland, seminal vesicle, and ejaculatory duct: comparison with prostatic adenocarcinoma and discussion of prostatic zonal embryogenesis.
20358591 2010 PAX2 mutations in fetal renal hypodysplasia.
20061933 2010 PAX2 distinguishes benign mesonephric and mullerian glandular lesions of the cervix from endocervical adenocarcinoma, including minimal deviation adenocarcinoma.
20061627 2010 Genome-wide scan of copy number variation in late-onset Alzheimer's disease.
19959718 2010 Whole-genome linkage and association scan in primary, nonsyndromic vesicoureteric reflux.
19954729 2009 A case of renal-coloboma syndrome associated with mental developmental delay exhibiting a novel PAX2 gene mutation.
19851209 2009 PAX 2: a novel Müllerian marker for serous papillary carcinomas to differentiate from micropapillary breast carcinoma.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19556301 2009 Renal recovery after injury: the role of Pax-2.
19525924 2009 PAX2 expression in low malignant potential ovarian tumors and low-grade ovarian serous carcinomas.
19517575 2009 Angiotensin II up-regulates PAX2 oncogene expression and activity in prostate cancer via the angiotensin II type I receptor.
19467152 2009 An intron 9 containing splice variant of PAX2.
19401348 2009 Loss of VHL and hypoxia provokes PAX2 up-regulation in clear cell renal cell carcinoma.
19228645 2009 PAX-2 in the diagnosis of primary renal tumors: immunohistochemical comparison with renal cell carcinoma marker antigen and kidney-specific cadherin.
19118900 2009 PAX2 oncogene negatively regulates the expression of the host defense peptide human beta defensin-1 in prostate cancer.
19048125 2008 WNT5A is regulated by PAX2 and may be involved in blastemal predominant Wilms tumorigenesis.
18941400 2009 Diagnostic implications of transcription factor Pax 2 protein and transmembrane enzyme complex carbonic anhydrase IX immunoreactivity in adult renal epithelial neoplasms.
18685487 2008 The utility of PAX-2 in distinguishing metastatic clear cell renal cell carcinoma from its morphologic mimics: an immunohistochemical study with comparison to renal cell carcinoma marker.
18609495 Bilateral macular detachment caused by bilateral optic nerve malformation in a papillorenal syndrome due to a new PAX2 mutation.
18439754 2008 In vivo validation of PAX2 as a target for renal cancer therapy.
18379529 2008 The case: familial renal failure with ocular abnormality.
18056486 2008 PAX2 expression by HHV-8-infected endothelial cells induced a proangiogenic and proinvasive phenotype.
18000879 2008 Novel interaction partners of Bardet-Biedl syndrome proteins.
17529925 2007 Expression of PAX2 in papillary serous carcinoma of the ovary: immunohistochemical evidence of fallopian tube or secondary Müllerian system origin?
17513325 2007 A common variant of the PAX2 gene is associated with reduced newborn kidney size.
17357786 2007 Pax-2 and N-myc regulate epithelial cell proliferation and apoptosis in a positive autocrine feedback loop.
17269592 2007 Renal-coloboma syndrome: a single nucleotide deletion in the PAX2 gene at Exon 8 is associated with a highly variable phenotype.
16971658 2006 Prevalence of mutations in renal developmental genes in children with renal hypodysplasia: results of the ESCAPE study.
16814811 2006 Paired box genes, PAX-2 and PAX-8, are not frequently mutated in Wilms tumor.
16735463 2006 Neuronal apoptosis inhibitory protein is expressed in developing kidney and is regulated by PAX2.
16609680 2006 PAX2 inactivation enhances cisplatin-induced apoptosis in renal carcinoma cells.
16509931 2006 Role of PAX2 gene polymorphisms in Henoch-Schonlein purpura nephritis.
16436683 2006 Expression of Pax2 in human renal tumor-derived endothelial cells sustains apoptosis resistance and angiogenesis.
16400326 2006 PAX2: a reliable marker for nephrogenic adenoma.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16368682 2006 PAX2 activates WNT4 expression during mammalian kidney development.
15808183 2005 De novo insG619 mutation in PAX2 gene in a Japanese patient with papillorenal syndrome.
15652857 2005 Macular abnormalities and optic disk anomaly associated with a new PAX2 missense mutation.
15561999 2004 Genomewide linkage searches for Mendelian disease loci can be efficiently conducted using high-density SNP genotyping arrays.
15502805 2005 Expression of aquaporins and PAX-2 compared to CD10 and cytokeratin 7 in renal neoplasms: a tissue microarray study.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14627715 2004 Role of Pax2 in apoptosis resistance and proinvasive phenotype of Kaposi's sarcoma cells.
14603255 2003 WT1 is a modifier of the Pax2 mutant phenotype: cooperation and interaction between WT1 and Pax2.
14566649 2003 Optic nerve dysplasia and renal insufficiency in a family with a novel PAX2 mutation, Arg115X: further ophthalmologic delineation of the renal-coloboma syndrome.
14561758 2003 The secreted frizzled related protein 2 (SFRP2) gene is a target of the Pax2 transcription factor.
12970747 2003 Paired-Box genes are frequently expressed in cancer and often required for cancer cell survival.
12697057 2003 Refined physical map of the human PAX2/HOX11/NFKB2 cancer gene region at 10q24 and relocalization of the HPV6AI1 viral integration site to 14q13.3-q21.1.
12200151 2002 Pax-2 interacts with RB and reverses its repression on the promoter of Rig-1, a Robo member.
12141441 2002 PAX genes in development and disease: the role of PAX2 in urogenital tract development.
11940591 2002 The HMG-I/Y-related protein p8 binds to p300 and Pax2 trans-activation domain-interacting protein to regulate the trans-activation activity of the Pax2A and Pax2B transcription factors on the glucagon gene promoter.
11700324 2002 Phosphorylation of Pax2 by the c-Jun N-terminal kinase and enhanced Pax2-dependent transcription activation.
11461952 2001 PAX2 gene mutation in a family with isolated renal hypoplasia.
11241473 2001 Renal-coloboma syndrome: prenatal detection and clinical spectrum in a large family.
11180607 2001 Identification of two novel polymorphisms (g.903C>T and g.1544C>T) in the PAX2 gene.
11168927 2001 PAX2 mutations in oligomeganephronia.
11134340 2001 Id helix-loop-helix proteins antagonize pax transcription factor activity by inhibiting DNA binding.
11093271 2000 PAX2 mutations in renal-coloboma syndrome: mutational hotspot and germline mosaicism.
10980123 2000 PAX2 suppresses apoptosis in renal collecting duct cells.
10938089 2000 The paired homeodomain transcription factor Pax-2 is expressed in the endocrine pancreas and transactivates the glucagon gene promoter.
10908331 2000 PTIP, a novel BRCT domain-containing protein interacts with Pax2 and is associated with active chromatin.
10533062 1999 Homonucleotide expansion and contraction mutations of PAX2 and inclusion of Chiari 1 malformation as part of renal-coloboma syndrome.
9760197 1998 Missense mutation and hexanucleotide duplication in the PAX2 gene in two unrelated families with renal-coloboma syndrome (MIM 120330).
9738017 1998 Cloning and characterization of the human PAX2 promoter.
9439670 1997 Alternative splicing in PAX2 generates a new reading frame and an extended conserved coding region at the carboxy terminus.
9297966 1997 Pax genes and organogenesis.
9178767 1997 Differential regulation of the human Wilms tumour suppressor gene (WT1) promoter by two isoforms of PAX2.
9132492 1997 Localisation of a 10q breakpoint within the PAX2 gene in a patient with a de novo t(10;13) translocation and optic nerve coloboma-renal disease.
9106533 1997 Further delineation of renal-coloboma syndrome in patients with extreme variability of phenotype and identical PAX2 mutations.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8760285 1996 The paired-box transcription factor, PAX2, positively modulates expression of the Wilms' tumor suppressor gene (WT1).
8661132 1996 Genomic structure of the human PAX2 gene.
8589702 1995 Mutation of PAX2 in two siblings with renal-coloboma syndrome.
8431641 1993 Mapping of the human homologs of the murine paired-box-containing genes.
8241771 1993 Evolution and role of Pax genes.
7981748 1993 Chromosomal localization of seven PAX genes and cloning of a novel family member, PAX-9.
7856737 1995 Comparative in situ hybridization analysis of PAX2, PAX8, and WT1 gene transcription in human fetal kidney and Wilms' tumors.
7819127 1994 Alternative messenger RNA forms and open reading frames within an additional conserved region of the human PAX-2 gene.
7795640 1995 Mutation of the PAX2 gene in a family with optic nerve colobomas, renal anomalies and vesicoureteral reflux.
1378753 1992 Expression of the PAX2 gene in human fetal kidney and Wilms' tumor.
1337742 1992 PAX8, a human paired box gene: isolation and expression in developing thyroid, kidney and Wilms' tumors.