Property Summary

NCBI Gene PubMed Count 33
PubMed Score 106.06
PubTator Score 48.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Otofaciocervical syndrome 2 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 6.3e-10
medulloblastoma, large-cell 6241 1.5e-04
facioscapulohumeral dystrophy 288 2.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Alopecia universalis 16 0.0 3.0
Disease Target Count
OTOFACIOCERVICAL SYNDROME 2 1

Expression

  Differential Expression (3)

Disease log2 FC p
facioscapulohumeral dystrophy 2.200 2.8e-03
medulloblastoma, large-cell 1.200 1.5e-04
ovarian cancer 1.200 6.3e-10

Gene RIF (17)

AA Sequence

MKFTLGLGSRAWRVSWEGAAAAAAGPGAGGSALRCRAQRVSSPRLGRRGSRLSGALPLCLSRGGGGAQAL      1 - 70
PDCAGPSPGHPGHPGARQLAGPLAMEQTYGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQL     71 - 140
RVSHGCVSKILARYNETGSILPGAIGGSKPRVTTPNVVKHIRDYKQGDPGIFAWEIRDRLLADGVCDKYN    141 - 210
VPSVSSISRILRNKIGSLAQPGPYEASKQPPSQPTLPYNHIYQYPYPSPVSPTGAKMGSHPGVPGTAGHV    211 - 280
SIPRSWPSAHSVSNILGIRTFMEQTGALAGSEGTAYSPKMEDWAGVNRTAFPATPAVNGLEKPALEADIK    281 - 350
YTQSASTLSAVGGFLPACAYPASNQHGVYSAPGGGYLAPGPPWPPAQGPPLAPPGAGVAVHGGELAAAMT    351 - 420
FKHPSREGSLPAPAARPRTPSVAYTDCPSRPRPPRGSSPRTRARRERQADPGAQVCAAAPAIGTGRIGGL    421 - 490
AEEEASAGPRGARPASPQAQPCLWPDPPHFLYWSGFLGFSELGF                              491 - 534
//

Text Mined References (35)

PMID Year Title