Tbio | PRKC apoptosis WT1 regulator protein |
Pro-apoptopic protein capable of selectively inducing apoptosis in cancer cells, sensitizing the cells to diverse apoptotic stimuli and causing regression of tumors in animal models. Induces apoptosis in certain cancer cells by activation of the Fas prodeath pathway and coparallel inhibition of NF-kappa-B transcriptional activity. Inhibits the transcriptional activation and augments the transcriptional repression mediated by WT1. Down-regulates the anti-apoptotic protein BCL2 via its interaction with WT1. Seems also to be a transcriptional repressor by itself. May be directly involved in regulating the amyloid precursor protein (APP) cleavage activity of BACE1.
This gene encodes a tumor suppressor protein that selectively induces apoptosis in cancer cells through intracellular and extracellular mechanisms. The intracellular mechanism involves the inhibition of pro-survival pathways and the activation of Fas-mediated apoptosis, while the extracellular mechanism involves the binding of a secreted form of this protein to glucose regulated protein 78 (GRP78) on the cell surface, which leads to activation of the extrinsic apoptotic pathway. This gene is located on the unstable human chromosomal 12q21 region and is often deleted or mutated different tumors. The encoded protein also plays an important role in the progression of age-related diseases. [provided by RefSeq, Aug 2017]
This gene encodes a tumor suppressor protein that selectively induces apoptosis in cancer cells through intracellular and extracellular mechanisms. The intracellular mechanism involves the inhibition of pro-survival pathways and the activation of Fas-mediated apoptosis, while the extracellular mechanism involves the binding of a secreted form of this protein to glucose regulated protein 78 (GRP78) on the cell surface, which leads to activation of the extrinsic apoptotic pathway. This gene is located on the unstable human chromosomal 12q21 region and is often deleted or mutated different tumors. The encoded protein also plays an important role in the progression of age-related diseases. [provided by RefSeq, Aug 2017]
Comments
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Adenocarcinoma | 122 | 0.0 | 0.0 |
Endometrial Neoplasms | 55 | 0.0 | 0.0 |
Prostatic Neoplasms | 495 | 0.0 | 0.0 |
Disease | Target Count | P-value |
---|---|---|
non-small cell lung cancer | 2890 | 1.5e-16 |
Breast cancer | 3578 | 1.7e-11 |
ovarian cancer | 8520 | 2.6e-07 |
atypical teratoid / rhabdoid tumor | 5112 | 7.1e-07 |
malignant mesothelioma | 3232 | 1.9e-05 |
cystic fibrosis | 1696 | 3.4e-05 |
psoriasis | 6694 | 1.3e-04 |
ependymoma | 4679 | 3.3e-04 |
glioblastoma | 5792 | 4.7e-04 |
Pick disease | 1894 | 7.0e-04 |
pediatric high grade glioma | 1064 | 2.1e-03 |
group 3 medulloblastoma | 4104 | 2.4e-03 |
lung cancer | 4740 | 3.3e-03 |
intraductal papillary-mucinous neoplasm (IPMN) | 3291 | 4.0e-03 |
intraductal papillary-mucinous adenoma (IPMA) | 2955 | 7.2e-03 |
acute myeloid leukemia | 783 | 1.2e-02 |
osteosarcoma | 7950 | 1.4e-02 |
ductal carcinoma in situ | 1745 | 1.9e-02 |
invasive ductal carcinoma | 2951 | 2.0e-02 |
spina bifida | 1074 | 3.1e-02 |
adrenocortical carcinoma | 1428 | 3.3e-02 |
intraductal papillary-mucinous carcinoma (IPMC) | 2989 | 4.0e-02 |
primitive neuroectodermal tumor | 3035 | 4.4e-02 |
Polycystic ovary syndrome | 360 | 4.4e-02 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Specific developmental disorder | 9 | 0.0 | 1.1 |
Disease | log2 FC | p |
---|---|---|
acute myeloid leukemia | -3.100 | 1.2e-02 |
adrenocortical carcinoma | -1.281 | 3.3e-02 |
atypical teratoid / rhabdoid tumor | 2.500 | 7.1e-07 |
Breast cancer | -1.600 | 1.7e-11 |
cystic fibrosis | -1.203 | 3.4e-05 |
ductal carcinoma in situ | 1.100 | 1.9e-02 |
ependymoma | 1.300 | 3.3e-04 |
glioblastoma | 1.800 | 4.7e-04 |
group 3 medulloblastoma | -1.600 | 2.4e-03 |
intraductal papillary-mucinous adenoma (... | 1.100 | 7.2e-03 |
intraductal papillary-mucinous carcinoma... | 1.400 | 4.0e-02 |
intraductal papillary-mucinous neoplasm ... | 1.300 | 4.0e-03 |
invasive ductal carcinoma | 1.900 | 2.0e-02 |
lung cancer | 1.500 | 3.3e-03 |
malignant mesothelioma | 1.100 | 1.9e-05 |
non-small cell lung cancer | 1.501 | 1.5e-16 |
osteosarcoma | -2.089 | 1.4e-02 |
ovarian cancer | -2.000 | 2.6e-07 |
pediatric high grade glioma | 1.200 | 2.1e-03 |
Pick disease | 1.400 | 7.0e-04 |
Polycystic ovary syndrome | -1.008 | 4.4e-02 |
primitive neuroectodermal tumor | 1.200 | 4.4e-02 |
psoriasis | 1.300 | 1.3e-04 |
spina bifida | -2.606 | 3.1e-02 |
MATGGYRTSSGLGGSTTDFLEEWKAKREKMRAKQNPPGPAPPGGGSSDAAGKPPAGALGTPAAAAANELN 1 - 70 NNLPGGAPAAPAVPGPGGVNCAVGSAMLTRAAPGPRRSEDEPPAASASAAPPPQRDEEEPDGVPEKGKSS 71 - 140 GPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAVNLLDPG 141 - 210 SSYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVV 211 - 280 RERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKTLLKVVGQLTR 281 - 340 //