Property Summary

NCBI Gene PubMed Count 96
PubMed Score 103.53
PubTator Score 118.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma 1.100 1.9e-05
psoriasis 1.300 1.3e-04
osteosarcoma -2.282 1.2e-04
posterior fossa group A ependymoma 1.900 2.6e-13
cystic fibrosis -1.203 3.4e-05
atypical teratoid / rhabdoid tumor 3.200 3.4e-07
glioblastoma 1.800 4.7e-04
primitive neuroectodermal tumor 1.300 1.7e-02
adrenocortical carcinoma -1.281 3.3e-02
non-small cell lung cancer 1.501 1.5e-16
intraductal papillary-mucinous adenoma (... 1.100 7.2e-03
intraductal papillary-mucinous carcinoma... 1.400 4.0e-02
intraductal papillary-mucinous neoplasm ... 1.300 4.0e-03
lung cancer 2.200 5.0e-06
pediatric high grade glioma 1.200 2.1e-03
group 4 medulloblastoma -2.000 7.8e-05
Polycystic Ovary Syndrome -1.008 4.4e-02
spina bifida -2.606 3.1e-02
Pick disease 1.400 7.0e-04
Breast cancer -1.600 1.7e-11
ductal carcinoma in situ 1.100 1.9e-02
invasive ductal carcinoma 1.900 2.0e-02
acute myeloid leukemia -3.200 6.7e-03
ovarian cancer -2.100 3.3e-06

Gene RIF (83)

PMID Text
26977019 Decreased PAR4 expression in breast cancer is associated with shorter survival. PAR4 suppresses growth and invasiveness of breast cancer cells.
26246468 Authors determined that PAR-4 induces cell apoptosis in response to stimuli, in vitro, but is also involved in the relocation of GRP78 from endoplasmic reticulum to the cell surface of ovarian cancer cell line.
25670650 These results suggest that Porphyromonas gingivalis activates PAR4 signaling pathways, leading proMMP9 over-expression and cellular invasion in oral squamous cell carcinoma cells.
25495701 PAR1-platelet releasate enhances vasculogenesis more potently than PAR4-platelet releasate, and the enhancements require a cooperation of multiple platelet-derived angiogenic regulators.
25373316 Data indicate that PAR1 and PAR4 activate common promigratory signalling pathways in Hep3B liver carcinoma cells including activation of the receptor tyrosine kinases Met and PDGFR, the formation of ROS and the inactivation of PTP1B.
25297082 These results indicate that the expression of PAR1 and PAR2 in esophageal squamous cell carcinoma is increased but PAR4 is decreased.
25195896 C-terminus of the rat homologue of Par-4 was crystallized and a 3.7 A resolution X-ray diffraction data set was collected
25001535 The cancer cell specific activity of Par-4 is elicited through intracellular as well as extracellular mechanisms.
24992930 a Par-4 mutant that is unable to bind Fbxo45 is stabilized and further enhances staurosporine-induced apoptosis.
24931006 our results indicate that the mechanism by which PAR-4 orchestrates the apoptotic process requires cleavage by caspase-8.
24795528 The addition of TRAIL to WIN 55.212-2-treated cells led to apoptotic death probably mediated by up-regulation of the tumor suppressor factor PAR-4, whose levels increased after WIN treatment, and by the translocation of GRP78 on cell surface.
24523904 prostate apoptosis response-4 (Par-4) has a role in human glioma stem cells in drug-induced apoptosis
24503536 Par-4 is a target of TGF-beta signaling and acts as an important factor during TGF-beta-induced epithelial-to-mesenchymal transition.
24457960 Phosphorylation by CK2 impairs Par-4 proapoptotic functions.
24418097 These results suggested a prognostic role of Par-4 in hypopharyngeal carcinoma.
24282526 Par-4 is expressed in trophoblastic cells and is involved in transport of GRP78 to the cell surface.
23975424 Par-4/THAP1 complex and Notch3 competitively regulated pre-mRNA splicing of CCAR1 and affected inversely the survival of T-cell acute lymphoblastic leukemia cells.
23906015 A novel long non-coding RNA T-ALL-R-LncR1 knockdown and Par-4 cooperate to induce cellular apoptosis in T-cell acute lymphoblastic leukemia cells.
23886184 Down-regulation of protease-activated receptor 4 in lung adenocarcinoma is associated with a more aggressive phenotype
23770012 Par-4-induced multinucleation as a mechanism of cell death in oncogene-addicted cells and establish Par-4 as a negative regulator of breast cancer recurrence.
23760770 Par-4 expression modulates apoptosis in response to docetaxel in MCF7 breast cancer cells.
23204231 our results identify a novel intracellular pathway of apoptosis mediated by NF-kappaB through UACA elevation, which by attenuating endoplasmic reticulum stress and GRP78 translocation to the cell surface can blunt the sensitivity of cancer cells to apoptosis.
22532571 a novel mechanism of apoptosis induction by PAR-4/ceramide-enriched exosomes, which may critically contribute to Alzheimer disease.
22184067 identified a novel specific caspase-3 cleavage site in Par-4, and the cleaved fragment of Par-4 retains proapoptotic activity
21764283 Gamma-tocotrienol inhibited IL-13/STAT6-activated eotaxin secretion via up-regulation of PAR4 expression and enhancement of aPKC-PAR4 complex formation.
21567071 17beta-estradiol and Insulin-like growth factor-1 inhibit PAR-4 gene expression in MCF-7 cells.
21555373 Par-4-overexpressing tumors exhibited a bystander effect on wild-type tumors growing distally in the same mouse.
21526495 The expression of PAR-4 protein in B cells correlated positively with the percentage of CD38(+) cells, as well as with CD38(+)/ZAP-70(+) cells.
21328340 The biological significance of PrPc association with par-4 provided the first evidence of a relationship between the endogenous levels of PrPc and the resistance of glioma cells to the apoptotic effects of TMZ.
20724592 Decreased Par-4 expression is associated with cholangiocarcinoma.
20637369 findings suggest that a lower expression level of Par-4 is related to an unfavorable prognosis in breast cancer patients
20514395 Downregulation of PAR4 is associated with poor prognosis in breast cancer.
20468064 Observational study of gene-disease association. (HuGE Navigator)
20433755 the initiation of apoptotic sensitivity in colon cancer cells can be mediated by Par-4 binding to NF kappaB
20368356 Data show that RASSF2 forms a direct and endogenous complex with prostate apoptosis response protein 4 (PAR-4) and that this interaction is regulated by K-Ras and is essential for the full apoptotic effects of PAR-4.
20127709 Expression of Par-4 sensitizes Caki cells to TRAIL via modulation of multiple targets, including DR5, Bcl-2, Akt, and NF-kappaB.
20082875 Results suggest that, in breast cancer, Par-4 plays a similar tumor suppressor gene role as reported in endometrial carcinoma, and that Par-4 expression has a significant inverse association with expression of progesterone receptor.
20067857 Compared to normal controls, mean Par-4 levels appeared slightly lower in schizophrenia and bipolar disorder. However, in major depression, Par-4 was decreased by 67% compared to normal controls.
19823030 Endoplasmic reticulum stress causes translocation of the Par-4-GRP78 complex from the ER to the plasma membrane, and through a positive feedback loop, extracellular Par-4 binds to cell surface GRP78 activating the extrinsic apoptotic pathway. Review.
19801652 These data suggest PAWR is a novel PITX2-interacting protein that regulates PITX2 activity in ocular cells.
19632185 Par-4 activates an extrinsic pathway involving cell surface GRP78 receptor for induction of apoptosis.
19470463 cooperation between Par-4 and PTEN as relevant for the development of prostate cancer and implicate the NF-kappaB pathway as a critical event in prostate tumorigenesis.
19250735 LMP-1 negatively influences the pro-apoptosis protein Par-4 by the coordination of multiple signaling pathways.
19099901 siRNA against Par-4 gene could inhibit the apoptosis of human bone marrow mesenchymal stem cells.
18991852 These results suggest that prostate apoptosis response 4 does not play a major role in methamphetamine-use disorders in the Japanese population.
18991852 Observational study of gene-disease association. (HuGE Navigator)
18922975 BMP-9 induced apoptosis in PC-3 cells through the up-regulation of prostate apoptosis response-4.
18836307 Par-4 is a tumor suppressor protein with a pro-apoptotic function. Epigenetic silencing of Par-4 is seen in diverse tumors, [REVIEW]
18676842 findings suggest that Par-4 serves as an intracellular repressor of TOP1 catalytic activity and regulates DNA topology to suppress cellular transformation
18660514 Expression of full-length Par-4 in human-bone mesenchymal cells resulted in increased activity of the Smac promoter.
18650932 The lack of Par-4 dramatically enhances Ras-induced lung carcinoma formation in vivo, acting as a negative regulator of Akt activation.
18506731 No association between genetic variations in the human PAWR gene and tardive dyskinesia in schizophrenia has been found.
18281137 Our results indicate that the PAWR gene is associated with schizophrenia in our population, and this study provides genetic evidence to support the dopamine hypothesis of schizophrenia.
18281137 Observational study of gene-disease association. (HuGE Navigator)
18085546 No significant genetic association was found with schizophrenia or Major Depressive Disorder or Bipolar Disorder.
18085546 Observational study of gene-disease association. (HuGE Navigator)
18041764 Levels of phospho-Akt are decreased in Caki cells overexpressing Par-4 cells to a significantly greater extent than in Caki/Vector cells by treatment with thapsigargin.This is associated with decreased levels of phospho-PDK1, the kinase upstream of Akt.
17893871 Downregulation of PAR-4, a pro-apoptotic gene, is associated with pancreatic tumors harboring K-ras mutation
17883592 Platelet PAR-1/PAR-4 stimulation causes rapid Akt phosphorylation downstream of PLC, whereas with continuous stimulation, ADP and PI3K are required for maintaining Akt phosphorylation.
17881119 Data suggest that the cytoplasmic localization and expression level of endogenous Par-4 in nasopharyngeal carcinoma cell lines are not sufficient to augment apoptosis.
17332319 Par-4 is a relevant tumor suppressor gene in human endometrial carcinogenesis.
16969273 Observational study of gene-disease association. (HuGE Navigator)
16966277 The induction of apoptosis by arsenic compounds was accompanied by down-regulation of hTERT and wt1 mRNA and protein expression but up-regulation of par-4.
16720717 Results suggest that, in addition to its proapoptotic function, par-4 acts as a novel transcription cofactor for androgen receptors to target c-FLIP gene expression.
16382046 review of prominent structural and functional features of Par-4 and the multiple levels of regulation of its apoptotic function [review]
16369487 SSB-1, SSB-2 and SSB-4, but not SSB-3, bind prostate apoptosis response protein-4 (Par-4)
15831492 the mechanism for Ras-mediated down-regulation of Par-4 is by promoter methylation
15671026 Data show that the C-terminal domain of PAR-4 is necessary for forming a complex with the cytosolic tail of BACE1.
15657440 Selective apoptosis of cancer cells by the SAC domain of Par-4 involves phosphorylation of T155 by PKA.
15359646 In the erythroleukemic cell line HEL, in contrast to other cell types, Par-4 fails to promote apoptosis, & instead upregulates BCL2, Daxx, & procaspases 8, 9, & 10.
15316756 Par-4 increases apoptosis by upregulating the CD95 receptor on the cell surface and, with concomitant decrease of the FLICE-like inhibitory protein (FLIP), by promoting cleavage of the initiator caspases-8 and -10.
15246161 Par-4 exhibits an antitransforming capacity by antagonizing p185(BCR-ABL)-induced factor-independent proliferation in hematopoietic cells.
15090548 Par-4 is directly involved in regulating choline uptake by interacting with CHT1 and by reducing its incorporation on the cell surface
15090548 Par-4 is directly involved in regulating choline uptake by interacting with CHT1 and reducing its incorporation to the cell surface.
13680279 death of dopaminergic neurons in Parkinson's disease follows a degenerative pathway that circumvents the induction of Par-4.
12897127 there is a unique death-inducing domain in PAR4 selective for apoptosis induction in cancer cells (SAC domain)
12717420 novel nuclear proapoptotic factor associated with PML NBs, which potentiates apoptosis, and interacts with Par-4
12685825 Par-4 enables cells to circumvent inhibition of the central executioner caspase-3 by alternative activation of caspases following a decrease in expression levels of inhibitors of apoptosis proteins
12644474 role in regulating Bcl-2 through a WT1-binding site on the bcl-2 promoter
11910304 mechanical strain increased PAR-4 gene expression in macrophages
11278808 Par-4 increases secretion of amyloid beta peptide 1-42, which contributes to the pathogenesis of Alzheimer's disease.
10393834 Par-4 expression is upregulated by HIV-1 Tat in hippocampal neurons and participates at an early stage of Tat-induced neuronal apoptosis, suggesting Par-4 may be a mediator of neuronal apoptosis in HIV encephalitis
9701251 Par-4 expression is increased in vulnerable neurons in Alzheimer's disease, and contributes to apoptotic neuronal cell death in the disease.

AA Sequence

MATGGYRTSSGLGGSTTDFLEEWKAKREKMRAKQNPPGPAPPGGGSSDAAGKPPAGALGTPAAAAANELN      1 - 70
NNLPGGAPAAPAVPGPGGVNCAVGSAMLTRAAPGPRRSEDEPPAASASAAPPPQRDEEEPDGVPEKGKSS     71 - 140
GPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAVNLLDPG    141 - 210
SSYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVV    211 - 280
RERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKTLLKVVGQLTR              281 - 340
//

Text Mined References (103)

PMID Year Title
26977019 2016 Prostate Apoptosis Response-4 (PAR4) Suppresses Growth and Invasion of Breast Cancer Cells and Is Positively Associated with Patient Survival.
26246468 2015 Role of PAR-4 in ovarian cancer.
25670650 2015 Involvement of protease-activated receptor 4 in over-expression of matrix metalloproteinase 9 induced by Porphyromonas gingivalis.
25495701 2015 PAR1-stimulated platelet releasate promotes angiogenic activities of endothelial progenitor cells more potently than PAR4-stimulated platelet releasate.
25373316 2015 Proteinase-activated receptor 1- and 4-promoted migration of Hep3B hepatocellular carcinoma cells depends on ROS formation and RTK transactivation.
25297082 2014 Protease-activated receptor (PAR)1, PAR2 and PAR4 expressions in esophageal squamous cell carcinoma.
25195896 2014 Cloning, expression, purification, crystallization and preliminary crystallographic analysis of the C-terminal domain of Par-4 (PAWR).
25001535 2014 Cancer-selective apoptosis by tumor suppressor par-4.
24992930 2014 Fbxo45-mediated degradation of the tumor-suppressor Par-4 regulates cancer cell survival.
24931006 2014 Caspase-8-mediated PAR-4 cleavage is required for TNF?-induced apoptosis.
24795528 2014 Involvement of PAR-4 in cannabinoid-dependent sensitization of osteosarcoma cells to TRAIL-induced apoptosis.
24523904 2014 Expression and regulation of prostate apoptosis response-4 (Par-4) in human glioma stem cells in drug-induced apoptosis.
24503536 2014 Prostate apoptosis response-4 mediates TGF-?-induced epithelial-to-mesenchymal transition.
24457960 2014 Regulation of the proapoptotic functions of prostate apoptosis response-4 (Par-4) by casein kinase 2 in prostate cancer cells.
24418097 2014 Concomitant induction of apoptosis and autophagy by prostate apoptosis response-4 in hypopharyngeal carcinoma cells.
24282526 2013 Role of prostate apoptosis response 4 in translocation of GRP78 from the endoplasmic reticulum to the cell surface of trophoblastic cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23975424 2013 Par-4/THAP1 complex and Notch3 competitively regulated pre-mRNA splicing of CCAR1 and affected inversely the survival of T-cell acute lymphoblastic leukemia cells.
23906015 2014 A novel long non-coding RNA T-ALL-R-LncR1 knockdown and Par-4 cooperate to induce cellular apoptosis in T-cell acute lymphoblastic leukemia cells.
23886184 2013 Down-regulation of protease-activated receptor 4 in lung adenocarcinoma is associated with a more aggressive phenotype.
23770012 2013 Par-4 downregulation promotes breast cancer recurrence by preventing multinucleation following targeted therapy.
23760770 2013 Prostate apoptosis response-4 is involved in the apoptosis response to docetaxel in MCF-7 breast cancer cells.
23204231 2013 Novel mechanism of apoptosis resistance in cancer mediated by extracellular PAR-4.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22532571 2012 Astrocytes secrete exosomes enriched with proapoptotic ceramide and prostate apoptosis response 4 (PAR-4): potential mechanism of apoptosis induction in Alzheimer disease (AD).
22184067 2012 Prostate apoptosis response 4 (Par-4), a novel substrate of caspase-3 during apoptosis activation.
21764283 2012 Vitamin E forms inhibit IL-13/STAT6-induced eotaxin-3 secretion by up-regulation of PAR4, an endogenous inhibitor of atypical PKC in human lung epithelial cells.
21567071 2011 Insulin-like growth factor-1 and 17?-estradiol down-regulate prostate apoptosis response-4 expression in MCF-7 breast cancer cells.
21555373 2011 The Akt inhibitor ISC-4 activates prostate apoptosis response protein-4 and reduces colon tumor growth in a nude mouse model.
21526495 2011 Assessment of the pathway of apoptosis involving PAR-4, DAXX and ZIPK proteins in CLL patients and its relationship with the principal prognostic factors.
21328340 2012 TMZ-induced PrPc/par-4 interaction promotes the survival of human glioma cells.
21269460 2011 Initial characterization of the human central proteome.
20724592 2010 Prostate apoptosis response-4 is expressed in normal cholangiocytes, is down-regulated in human cholangiocarcinoma, and promotes apoptosis of neoplastic cholangiocytes when induced pharmacologically.
20637369 2010 Immunohistochemical analysis of prostate apoptosis response-4 (Par-4) in Mexican women with breast cancer: a preliminary study.
20561531 2010 Structural basis for Par-4 recognition by the SPRY domain- and SOCS box-containing proteins SPSB1, SPSB2, and SPSB4.
20514395 2010 Down-regulation of the candidate tumor suppressor gene PAR-4 is associated with poor prognosis in breast cancer.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20433755 2010 Prostate apoptosis response protein 4 sensitizes human colon cancer cells to chemotherapeutic 5-FU through mediation of an NF kappaB and microRNA network.
20368356 2010 The Ras effector RASSF2 controls the PAR-4 tumor suppressor.
20127709 2010 Overexpression of Par-4 sensitizes TRAIL-induced apoptosis via inactivation of NF-kappaB and Akt signaling pathways in renal cancer cells.
20082875 2009 Expression of prostate apoptosis response (Par-4) is associated with progesterone receptor in breast cancer.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20067857 2010 Pro-apoptotic Par-4 and dopamine D2 receptor in temporal cortex in schizophrenia, bipolar disorder and major depression.
19823030 2009 The Par-4-GRP78 TRAIL, more twists and turns.
19801652 2009 Human PRKC apoptosis WT1 regulator is a novel PITX2-interacting protein that regulates PITX2 transcriptional activity in ocular cells.
19632185 2009 The tumor suppressor Par-4 activates an extrinsic pathway for apoptosis.
19470463 2009 Simultaneous inactivation of Par-4 and PTEN in vivo leads to synergistic NF-kappaB activation and invasive prostate carcinoma.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19250735 2009 EBV LMP-1 negatively regulates expression and pro-apoptotic activity of Par-4 in nasopharyngeal carcinoma cells.
19099901 2008 [Effects of small interfering RNA (siRNA) against Par-4 gene on the apoptosis of human bone marrow mesenchymal stem cells].
18991852 2008 Prostate apoptosis response 4 gene is not associated with methamphetamine-use disorder in the Japanese population.
18951430 2008 Conduct disorder and ADHD: evaluation of conduct problems as a categorical and quantitative trait in the international multicentre ADHD genetics study.
18922975 2008 Bone morphogenetic protein-9 induces apoptosis in prostate cancer cells, the role of prostate apoptosis response-4.
18836307 2008 Apoptosis and tumor resistance conferred by Par-4.
18676842 2008 Par-4 binds to topoisomerase 1 and attenuates its DNA relaxation activity.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18660514 2008 Multimolecular complex of Par-4 and E2F1 binding to Smac promoter contributes to glutamate-induced apoptosis in human- bone mesenchymal stem cells.
18650932 2008 Par-4 inhibits Akt and suppresses Ras-induced lung tumorigenesis.
18506731 2009 Analysis of genetic variations in the human Par-4 (PAWR) gene and tardive dyskinesia in schizophrenia.
18281137 2008 Association of missense variants of the PRKC, apoptosis, WT1, regulator (PAWR) gene with schizophrenia.
18085546 2008 No association between prostate apoptosis response 4 gene (PAWR) in schizophrenia and mood disorders in a Japanese population.
18041764 2008 Overexpression of Par-4 enhances thapsigargin-induced apoptosis via down-regulation of XIAP and inactivation of Akt in human renal cancer cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17893871 2008 Downregulation of PAR-4, a pro-apoptotic gene, in pancreatic tumors harboring K-ras mutation.
17883592 2007 Protease-activated receptor-induced Akt activation--regulation and possible function.
17881119 2007 Protein expression and intracellular localization of prostate apoptosis response-4 (Par-4) are associated with apoptosis induction in nasopharyngeal carcinoma cell lines.
17332319 2007 Inactivation of the candidate tumor suppressor par-4 in endometrial cancer.
17189197 2006 Structural basis for protein recognition by B30.2/SPRY domains.
16969273 2006 No association between polymorphisms in the prostate apoptosis factor-4 gene and cocaine dependence.
16966277 2006 Down-regulation of wt1 expression in leukemia cell lines as part of apoptotic effect in arsenic treatment using two compounds.
16720717 2006 Androgen receptor and prostate apoptosis response factor-4 target the c-FLIP gene to determine survival and apoptosis in the prostate gland.
16382046 2005 Regulation of cancer cell survival by Par-4.
16369487 2006 The SPRY domain of SSB-2 adopts a novel fold that presents conserved Par-4-binding residues.
15831492 2005 Ras-mediated loss of the pro-apoptotic response protein Par-4 is mediated by DNA hypermethylation through Raf-independent and Raf-dependent signaling cascades in epithelial cells.
15671026 2005 PAR-4 is involved in regulation of beta-secretase cleavage of the Alzheimer amyloid precursor protein.
15657440 2005 Phosphorylation of Par-4 by protein kinase A is critical for apoptosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15359646 2004 In the erythroleukemic cell line HEL Prostate-apoptosis-response-gene-4 (par-4) fails to down-regulate Bcl-2 and to promote apoptosis.
15316756 2004 Prostate apoptosis response gene-4 sensitizes neoplastic lymphocytes to CD95-induced apoptosis.
15246161 2004 Prostate apoptosis response gene-4 (par-4) abrogates the survival function of p185(BCR-ABL) in hematopoietic cells.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15090548 2004 Par-4 inhibits choline uptake by interacting with CHT1 and reducing its incorporation on the plasma membrane.
14755681 2004 Par-4 inducible apoptosis in prostate cancer cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14627703 2004 AATF inhibits aberrant production of amyloid beta peptide 1-42 by interacting directly with Par-4.
13680279 2004 Absence of prostate apoptosis response-4 protein in substantia nigra of Parkinson's disease autopsies.
12917339 2003 ZIP kinase triggers apoptosis from nuclear PML oncogenic domains.
12897127 2003 Identification of a unique core domain of par-4 sufficient for selective apoptosis induction in cancer cells.
12717420 2003 THAP1 is a nuclear proapoptotic factor that links prostate-apoptosis-response-4 (Par-4) to PML nuclear bodies.
12685825 2002 Expression and function of prostate-apoptosis-response-gene-4 in lymphatic cells.
12644474 2003 Par-4 transcriptionally regulates Bcl-2 through a WT1-binding site on the bcl-2 promoter.
12565819 2003 Apoptosis by Par-4 in cancer and neurodegenerative diseases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12242017 2002 Structural and functional characterization of the upstream regulatory region of the human gene encoding prostate apoptosis response factor-4.
11910304 2002 Identification of mechanically induced genes in human monocytic cells by DNA microarrays.
11755531 2002 p62 forms a ternary complex with PKCzeta and PAR-4 and antagonizes PAR-4-induced PKCzeta inhibition.
11585763 2001 Par-4 drives trafficking and activation of Fas and Fasl to induce prostate cancer cell apoptosis and tumor regression.
11278808 2001 Prostate apoptosis response-4 enhances secretion of amyloid beta peptide 1-42 in human neuroblastoma IMR-32 cells by a caspase-dependent pathway.
10393834 1999 Evidence that Par-4 participates in the pathogenesis of HIV encephalitis.
9790775 1998 Mapping of the human PAWR (par-4) gene to chromosome 12q21.
9701251 1998 Par-4 is a mediator of neuronal degeneration associated with the pathogenesis of Alzheimer disease.
8943350 1996 A novel repressor, par-4, modulates transcription and growth suppression functions of the Wilms' tumor suppressor WT1.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.