Property Summary

NCBI Gene PubMed Count 33
PubMed Score 77.09
PubTator Score 41.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Gene RIF (9)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19563532 Signalling molecules and effectors can be integrated into a functional network by the scaffold organizer protein PATJ via its multiple PDZ domains.
19255144 Results suggest that signaling mediated by Pals1, which has a higher affinity for Patj than for MUPP1 and is involved in the activation of the Par6-aPKC complex, is of principal importance for the function of Patj in epithelial cells.
19138174 Data show taht channel-interacting PDZ protein, 'CIPP', interacts with proteins involved in cytoskeletal dynamics.
18824598 the directional migration of capillaries in the embryo is governed by the Amot:Patj/Mupp1:Syx signaling that controls local GTPase activity
17287269 We have identified the tight junction-associated multi-PDZ protein PATJ (PALS1-associated TJ protein) as a novel binding partner and degradation target of high-risk types 16 and 18 E6.
17235357 PATJ controls directional migration by regulating the localization of aPKC and Par3 to the leading edge of epithelial cells.
16129888 Data show that PATJ regulates the spatial concentration of several tight junction components at the border between the apical and lateral domains in Caco-2 cells.
11964389 interaction with crumbs and localization to tight junctions in epithelial cells

AA Sequence

MPENPATDKLQVLQVLDRLKMKLQEKGDTSQNEKLSMFYETLKSPLFNQILTLQQSIKQLKGQLNHIPSD      1 - 70
CSANFDFSRKGLLVFTDGSITNGNVHRPSNNSTVSGLFPWTPKLGNEDFNSVIQQMAQGRQIEYIDIERP     71 - 140
STGGLGFSVVALRSQNLGKVDIFVKDVQPGSVADRDQRLKENDQILAINHTPLDQNISHQQAIALLQQTT    141 - 210
GSLRLIVAREPVHTKSSTSSSLNDTTLPETVCWGHVEEVELINDGSGLGFGIVGGKTSGVVVRTIVPGGL    211 - 280
ADRDGRLQTGDHILKIGGTNVQGMTSEQVAQVLRNCGNSVRMLVARDPAGDISVTPPAPAALPVALPTVA    281 - 350
SKGPGSDSSLFETYNVELVRKDGQSLGIRIVGYVGTSHTGEASGIYVKSIIPGSAAYHNGHIQVNDKIVA    351 - 420
VDGVNIQGFANHDVVEVLRNAGQVVHLTLVRRKTSSSTSPLEPPSDRGTVVEPLKPPALFLTGAVETETN    421 - 490
VDGEDEEIKERIDTLKNDNIQALEKLEKVPDSPENELKSRWENLLGPDYEVMVATLDTQIADDAELQKYS    491 - 560
KLLPIHTLRLGVEVDSFDGHHYISSIVSGGPVDTLGLLQPEDELLEVNGMQLYGKSRREAVSFLKEVPPP    561 - 630
FTLVCCRRLFDDEASVDEPRRTETSLPETEVDHNMDVNTEEDDDGELALWSPEVKIVELVKDCKGLGFSI    631 - 700
LDYQDPLDPTRSVIVIRSLVADGVAERSGGLLPGDRLVSVNEYCLDNTSLAEAVEILKAVPPGLVHLGIC    701 - 770
KPLVEDNEEESCYILHSSSNEDKTEFSGTIHDINSSLILEAPKGFRDEPYFKEELVDEPFLDLGKSFHSQ    771 - 840
QKEIEQSKEAWEMHEFLTPRLQEMDEEREILVDEEYELYQDPSPSMELYPLSHIQEATPVPSVNELHFGT    841 - 910
QWLHDNEPSESQEARTGRTVYSQEAQPYGYCPENVMKENFVMESLPSVPSTEGNSQQGRFDDLENLNSLA    911 - 980
KTSLDLGMIPNDVQGPSLLIDLPVVAQRREQEDLPLYQHQATRVISKASAYTGMLSSRYATDTCELPERE    981 - 1050
EGEGEETPNFSHWGPPRIVEIFREPNVSLGISIVGGQTVIKRLKNGEELKGIFIKQVLEDSPAGKTNALK   1051 - 1120
TGDKILEVSGVDLQNASHSEAVEAIKNAGNPVVFIVQSLSSTPRVIPNVHNKANKITGNQNQDTQEKKEK   1121 - 1190
RQGTAPPPMKLPPPYKALTDDSDENEEEDAFTDQKIRQRYADLPGELHIIELEKDKNGLGLSLAGNKDRS   1191 - 1260
RMSIFVVGINPEGPAAADGRMRIGDELLEINNQILYGRSHQNASAIIKTAPSKVKLVFIRNEDAVNQMAV   1261 - 1330
TPFPVPSSSPSSIEDQSGTEPISSEEDGSVEVGIKQLPESESFKLAVSQMKQQKYPTKVSFSSQEIPLAP   1331 - 1400
ASSYHSTDADFTGYGGFQAPLSVDPATCPIVPGQEMIIEISKGRSGLGLSIVGGKDTPLNAIVIHEVYEE   1401 - 1470
GAAARDGRLWAGDQILEVNGVDLRNSSHEEAITALRQTPQKVRLVVYRDEAHYRDEENLEIFPVDLQKKA   1471 - 1540
GRGLGLSIVGKRNGSGVFISDIVKGGAADLDGRLIQGDQILSVNGEDMRNASQETVATILKCAQGLVQLE   1541 - 1610
IGRLRAGSWTSARTTSQNSQGSQQSAHSSCHPSFAPVITGLQNLVGTKRVSDPSQKNSGTDMEPRTVEIN   1611 - 1680
RELSDALGISIAGGRGSPLGDIPVFIAMIQASGVAARTQKLKVGDRIVSINGQPLDGLSHADVVNLLKNA   1681 - 1750
YGRIILQVVADTNISAIAAQLENMSTGYHLGSPTAEHHPEDTEEQLQMTAD                      1751 - 1801
//

Text Mined References (40)

PMID Year Title
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22006950 2011 Lulu2 regulates the circumferential actomyosin tensile system in epithelial cells through p114RhoGEF.
21481793 2011 A tight junction-associated Merlin-angiomotin complex mediates Merlin's regulation of mitogenic signaling and tumor suppressive functions.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19563532 2009 Pals-associated tight junction protein functionally links dopamine and angiotensin II to the regulation of sodium transport in renal epithelial cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19255144 2009 Similar and distinct properties of MUPP1 and Patj, two homologous PDZ domain-containing tight-junction proteins.
19138174 2009 Channel-interacting PDZ protein, 'CIPP', interacts with proteins involved in cytoskeletal dynamics.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18824598 2009 The Amot/Patj/Syx signaling complex spatially controls RhoA GTPase activity in migrating endothelial cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18596123 2008 KIBRA modulates directional migration of podocytes.
17287269 2007 PATJ, a tight junction-associated PDZ protein, is a novel degradation target of high-risk human papillomavirus E6 and the alternatively spliced isoform 18 E6.
17235357 2007 PATJ regulates directional migration of mammalian epithelial cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16678097 2006 A Rich1/Amot complex regulates the Cdc42 GTPase and apical-polarity proteins in epithelial cells.
16637659 2006 Uncovering quantitative protein interaction networks for mouse PDZ domains using protein microarrays.
16129888 2005 PATJ connects and stabilizes apical and lateral components of tight junctions in human intestinal cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15241471 2004 Structural basis for L27 domain-mediated assembly of signaling and cell polarity complexes.
12771187 2003 The Crumbs3-Pals1 complex participates in the establishment of polarity in mammalian epithelial cells.
12527193 2003 Mammalian Crumbs3 is a small transmembrane protein linked to protein associated with Lin-7 (Pals1).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12021270 2002 The carboxyl terminus of zona occludens-3 binds and recruits a mammalian homologue of discs lost to tight junctions.
11964389 2002 hINADl/PATJ, a homolog of discs lost, interacts with crumbs and localizes to tight junctions in human epithelial cells.
11927608 2002 The Maguk protein, Pals1, functions as an adapter, linking mammalian homologues of Crumbs and Discs Lost.
11872753 2002 The multivalent PDZ domain-containing protein CIPP is a partner of acid-sensing ion channel 3 in sensory neurons.
11509564 2001 Distinct binding specificity of the multiple PDZ domains of INADL, a human protein with homology to INAD from Drosophila melanogaster.
11374908 2001 Isolation of novel heart-specific genes using the BodyMap database.
10079096 1999 PDZ domains: fundamental building blocks in the organization of protein complexes at the plasma membrane.
9647694 1998 CIPP, a novel multivalent PDZ domain protein, selectively interacts with Kir4.0 family members, NMDA receptor subunits, neurexins, and neuroligins.
9280290 1997 Molecular characterization of a novel human PDZ domain protein with homology to INAD from Drosophila melanogaster.
8617505 1996 The I.M.A.G.E. Consortium: an integrated molecular analysis of genomes and their expression.