Property Summary

NCBI Gene PubMed Count 46
PubMed Score 17.42
PubTator Score 18.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
active ulcerative colitis 1.330 3.7e-02
adult high grade glioma -1.100 2.1e-03
dermatomyositis -1.200 4.2e-04
glioblastoma 1.300 4.1e-03
interstitial cystitis 1.300 2.9e-02
intraductal papillary-mucinous carcinoma... -1.100 1.0e-03
oligodendroglioma -1.300 7.4e-04
osteosarcoma -1.652 1.5e-05
ovarian cancer 1.100 1.4e-04
psoriasis -1.200 8.3e-04
Rheumatoid arthritis -1.500 1.7e-02
spina bifida 1.126 4.0e-02

Protein-protein Interaction (2)

Gene RIF (24)

AA Sequence

MSSAPRSPTPRPRRMKKDESFLGKLGGTLARKRRAREVSDLQEEGKNAINSPMSPALVDVHPEDTQLEEN      1 - 70
EERTMIDPTSKEDPKFKELVKVLLDWINDVLVEERIIVKQLEEDLYDGQVLQKLLEKLAGCKLNVAEVTQ     71 - 140
SEIGQKQKLQTVLEAVHDLLRPRGWALRWSVDSIHGKNLVAILHLLVSLAMHFRAPIRLPEHVTVQVVVV    141 - 210
RKREGLLHSSHISEELTTTTEMMMGRFERDAFDTLFDHAPDKLSVVKKSLITFVNKHLNKLNLEVTELET    211 - 280
QFADGVYLVLLMGLLEDYFVPLHHFYLTPESFDQKVHNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTL    281 - 350
RVLYNLFTKYKNVE                                                            351 - 364
//

Text Mined References (51)

PMID Year Title