Property Summary

NCBI Gene PubMed Count 48
PubMed Score 236.57
PubTator Score 23.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma -1.130 7.7e-05
astrocytic glioma -1.300 2.9e-02
atypical teratoid / rhabdoid tumor 1.100 2.7e-03
Breast cancer -1.300 7.4e-12
chronic rhinosinusitis -1.043 1.1e-03
colon cancer -1.900 5.2e-03
cutaneous lupus erythematosus -1.100 3.6e-02
diabetes mellitus -1.200 3.9e-03
invasive ductal carcinoma -1.400 1.9e-03
lung cancer -1.100 1.3e-02
malignant mesothelioma -1.300 1.6e-06
ovarian cancer -1.600 7.6e-11
Polycystic ovary syndrome -1.102 4.3e-03

Protein-protein Interaction (8)

Gene RIF (17)

AA Sequence

MATSPQKSPSVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSELQEEGMNAINLPLSPIPFELDP      1 - 70
EDTMLEENEVRTMVDPNSRSDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEK     71 - 140
LNVAEVTQSEIAQKQKLQTVLEKINETLKLPPRSIKWNVDSVHAKSLVAILHLLVALSQYFRAPIRLPDH    141 - 210
VSIQVVVVQKREGILQSRQIQEEITGNTEALSGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLN    211 - 280
LEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIV    281 - 350
NCDLKSTLRVLYNLFTKYRNVE                                                    351 - 372
//

Text Mined References (55)

PMID Year Title