Property Summary

NCBI Gene PubMed Count 13
PubMed Score 146.98
PubTator Score 64.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma 1.200 9.1e-07
osteosarcoma -2.148 7.9e-03
glioblastoma 1.600 6.0e-04
group 3 medulloblastoma 2.300 1.1e-06
atypical teratoid / rhabdoid tumor 1.900 1.9e-05
medulloblastoma, large-cell 2.500 6.1e-06
primitive neuroectodermal tumor 1.800 5.8e-04
adrenocortical carcinoma 1.507 9.4e-04
non-small cell lung cancer 1.425 3.1e-18
intraductal papillary-mucinous neoplasm ... 1.200 4.8e-03
colon cancer 1.700 3.5e-02
lung cancer 4.500 8.6e-08
active Crohn's disease 1.037 1.3e-02
pediatric high grade glioma 1.400 4.7e-05
nasopharyngeal carcinoma 2.000 6.9e-06
Breast cancer 1.300 2.6e-06
ovarian cancer 1.300 1.5e-03
psoriasis 1.500 1.0e-56

Gene RIF (6)

PMID Text
26792895 PARI inhibits homologous recombination in vivo, and its knockdown suppresses the UV sensitivity of RAD18-depleted cells
23436799 PARI overexpression promotes genomic instability and pancreatic tumorigenesis.
23039964 Knockdown of C12orf48 by siRNA in HeLa cells significantly suppressed their growth
22153967 PARI suppresses inappropriate recombination events at mammalian replication forks.
20931645 Demonstrated that C12orf48 protein could directly interact with Poly(ADP-ribose) Polymerase-1 (PARP-1). Knockdown of C12orf48 by siRNA in PDAC cells significantly suppressed their growth.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAVFNQKSVSDMIKEFRKNWRALCNSERTTLCGADSMLLALQLSMAENNKQHSGEFTVSLSDVLLTWKYL      1 - 70
LHEKLNLPVENMDVTDHYEDVRKIYDDFLKNSNMLDLIDVYQKCRALTSNCENYNTVSPSQLLDFLSGKQ     71 - 140
YAVGDETDLSIPTSPTSKYNRDNEKVQLLARKIIFSYLNLLVNSKNDLAVAYILNIPDRGLGREAFTDLK    141 - 210
HAAREKQMSIFLVATSFIRTIELGGKGYAPPPSDPLRTHVKGLSNFINFIDKLDEILGEIPNPSIAGGQI    211 - 280
LSVIKMQLIKGQNSRDPFCKAIEEVAQDLDLRIKNIINSQEGVVALSTTDISPARPKSHAINHGTAYCGR    281 - 350
DTVKALLVLLDEEAANAPTKNKAELLYDEENTIHHHGTSILTLFRSPTQVNNSIKPLRERICVSMQEKKI    351 - 420
KMKQTLIRSQFACTYKDDYMISKDNWNNVNLASKPLCVLYMENDLSEGVNPSVGRSTIGTSFGNVHLDRS    421 - 490
KNEKVSRKSTSQTGNKSSKRKQVDLDGENILCDNRNEPPQHKNAKIPKKSNDSQNRLYGKLAKVAKSNKC    491 - 560
TAKDKLISGQAKLTQFFRL                                                       561 - 579
//

Text Mined References (14)

PMID Year Title
26792895 2016 The PCNA-associated protein PARI negatively regulates homologous recombination via the inhibition of DNA repair synthesis.
24396997 2013 Meta-analysis of the cell cycle related C12orf48.
23436799 2013 PARI overexpression promotes genomic instability and pancreatic tumorigenesis.
23039964 2012 GeneFriends: an online co-expression analysis tool to identify novel gene targets for aging and complex diseases.
22153967 2012 Inhibition of homologous recombination by the PCNA-interacting protein PARI.
20931645 2011 C12orf48, termed PARP-1 binding protein, enhances poly(ADP-ribose) polymerase-1 (PARP-1) activity and protects pancreatic cancer cells from DNA damage.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19893584 2010 Identification of 15 loci influencing height in a Korean population.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.