Property Summary

NCBI Gene PubMed Count 19
PubMed Score 19.28
PubTator Score 151.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
active Crohn's disease 2.271 9.8e-04
active ulcerative colitis 1.528 9.4e-03
adult high grade glioma 2.200 1.6e-06
astrocytoma 1.300 2.1e-11
Astrocytoma, Pilocytic 2.500 6.2e-12
Atopic dermatitis 1.300 4.4e-04
Breast cancer 1.200 1.0e-06
breast carcinoma 1.200 1.6e-28
cystic fibrosis 1.300 1.8e-03
ependymoma 2.200 2.1e-12
glioblastoma 2.000 3.9e-08
hepatocellular carcinoma 1.100 6.5e-03
interstitial cystitis 1.400 1.1e-03
intraductal papillary-mucinous neoplasm ... 1.300 3.6e-02
invasive ductal carcinoma 1.400 1.5e-03
juvenile dermatomyositis 3.047 3.6e-18
medulloblastoma, large-cell 1.200 1.3e-04
Multiple Sclerosis 2.000 9.4e-04
osteosarcoma -1.032 2.9e-02
ovarian cancer -1.600 4.2e-04
pancreatic cancer 1.700 1.2e-03
primary pancreatic ductal adenocarcinoma 1.498 6.7e-04
primary Sjogren syndrome 1.200 8.5e-03
progressive supranuclear palsy -1.200 8.5e-03
psoriasis 1.800 9.7e-44
subependymal giant cell astrocytoma 2.360 5.0e-03
tuberculosis 1.200 5.9e-03

Gene RIF (8)

AA Sequence

MDFSMVAGAAAYNEKSGRITSLSLLFQKVFAQIFPQWRKGNTEECLPYKCSETGALGENYSWQIPINHND      1 - 70
FKILKNNERQLCEVLQNKFGCISTLVSPVQEGNSKSLQVFRKMLTPRIELSVWKDDLTTHAVDAVVNAAN     71 - 140
EDLLHGGGLALALVKAGGFEIQEESKQFVARYGKVSAGEIAVTGAGRLPCKQIIHAVGPRWMEWDKQGCT    141 - 210
GKLQRAIVSILNYVIYKNTHIKTVAIPALSSGIFQFPLNLCTKTIVETIRVSLQGKPMMSNLKEIHLVSN    211 - 280
EDPTVAAFKAASEFILGKSELGQETTPSFNAMVVNNLTLQIVQGHIEWQTADVIVNSVNPHDITVGPVAK    281 - 350
SILQQAGVEMKSEFLATKAKQFQRSQLVLVTKGFNLFCKYIYHVLWHSEFPKPQILKHAMKECLEKCIEQ    351 - 420
NITSISFPALGTGNMEIKKETAAEILFDEVLTFAKDHVKHQLTVKFVIFPTDLEIYKAFSSEMAKRSKML    421 - 490
SLNNYSVPQSTREEKRENGLEARSPAINLMGFNVEEMYEAHAWIQRILSLQNHHIIENNHILYLGRKEHD    491 - 560
ILSQLQKTSSVSITEIISPGRTELEIEGARADLIEVVMNIEDMLCKVQEEMARKKERGLWRSLGQWTIQQ    561 - 630
QKTQDEMKENIIFLKCPVPPTQELLDQKKQFEKCGLQVLKVEKIDNEVLMAAFQRKKKMMEEKLHRQPVS    631 - 700
HRLFQQVPYQFCNVVCRVGFQRMYSTPCDPKYGAGIYFTKNLKNLAEKAKKISAADKLIYVFEAEVLTGF    701 - 770
FCQGHPLNIVPPPLSPGAIDGHDSVVDNVSSPETFVIFSGMQAIPQYLWTCTQEYVQSQDYSSGPMRPFA    771 - 840
QHPWRGFASGSPVD                                                            841 - 854
//

Text Mined References (22)

PMID Year Title