Property Summary

NCBI Gene PubMed Count 32
PubMed Score 23.76
PubTator Score 24.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Malignant tumor of ovary 25
Disease Target Count P-value
lung carcinoma 2844 1.4e-26
diabetes mellitus 1663 1.0e-03
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Heart disease 279 0.0 1.0
Osteoporosis 259 0.0 1.0

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.200 1.0e-03
lung carcinoma -1.400 1.4e-26

Gene RIF (13)

PMID Text
26699384 PARP4 is a possible susceptibility gene of primary thyroid and breast cancer
23739867 the protein levels of MVP, TEP1 and vPARP are actually increased in the highergrade tumors suggesting existence of post-transcriptional regulation of vault component production.
22190034 HIV-1 PR is identified to have a physical interaction with poly (ADP-ribose) polymerase family, member 4 (PARP4) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19536092 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
17203305 Observational study of gene-disease association. (HuGE Navigator)
15781132 HIV-1 PR is identified to have a physical interaction with poly (ADP-ribose) polymerase family, member 4 (PARP4) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12829019 REVIEW:recent findings suggesting that PARP-1 participates in DNA damage signaling in cell death
12404116 HIV-1 PR is identified to have a physical interaction with poly (ADP-ribose) polymerase family, member 4 (PARP4) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MVMGIFANCIFCLKVKYLPQQQKKKLQTDIKENGGKFSFSLNPQCTHIILDNADVLSQYQLNSIQKNHVH      1 - 70
IANPDFIWKSIREKRLLDVKNYDPYKPLDITPPPDQKASSSEVKTEGLCPDSATEEEDTVELTEFGMQNV     71 - 140
EIPHLPQDFEVAKYNTLEKVGMEGGQEAVVVELQCSRDSRDCPFLISSHFLLDDGMETRRQFAIKKTSED    141 - 210
ASEYFENYIEELKKQGFLLREHFTPEATQLASEQLQALLLEEVMNSSTLSQEVSDLVEMIWAEALGHLEH    211 - 280
MLLKPVNRISLNDVSKAEGILLLVKAALKNGETAEQLQKMMTEFYRLIPHKGTMPKEVNLGLLAKKADLC    281 - 350
QLIRDMVNVCETNLSKPNPPSLAKYRALRCKIEHVEQNTEEFLRVRKEVLQNHHSKSPVDVLQIFRVGRV    351 - 420
NETTEFLSKLGNVRPLLHGSPVQNIVGILCRGLLLPKVVEDRGVQRTDVGNLGSGIYFSDSLSTSIKYSH    421 - 490
PGETDGTRLLLICDVALGKCMDLHEKDFSLTEAPPGYDSVHGVSQTASVTTDFEDDEFVVYKTNQVKMKY    491 - 560
IIKFSMPGDQIKDFHPSDHTELEEYRPEFSNFSKVEDYQLPDAKTSSSTKAGLQDASGNLVPLEDVHIKG    561 - 630
RIIDTVAQVIVFQTYTNKSHVPIEAKYIFPLDDKAAVCGFEAFINGKHIVGEIKEKEEAQQEYLEAVTQG    631 - 700
HGAYLMSQDAPDVFTVSVGNLPPKAKVLIKITYITELSILGTVGVFFMPATVAPWQQDKALNENLQDTVE    701 - 770
KICIKEIGTKQSFSLTMSIEMPYVIEFIFSDTHELKQKRTDCKAVISTMEGSSLDSSGFSLHIGLSAAYL    771 - 840
PRMWVEKHPEKESEACMLVFQPDLDVDLPDLASESEVIICLDCSSSMEGVTFLQAKQIALHALSLVGEKQ    841 - 910
KVNIIQFGTGYKELFSYPKHITSNTMAAEFIMSATPTMGNTDFWKTLRYLSLLYPARGSRNILLVSDGHL    911 - 980
QDESLTLQLVKRSRPHTRLFACGIGSTANRHVLRILSQCGAGVFEYFNAKSKHSWRKQIEDQMTRLCSPS    981 - 1050
CHSVSVKWQQLNPDVPEALQAPAQVPSLFLNDRLLVYGFIPHCTQATLCALIQEKEFRTMVSTTELQKTT   1051 - 1120
GTMIHKLAARALIRDYEDGILHENETSHEMKKQTLKSLIIKLSKENSLITQFTSFVAVEKRDENESPFPD   1121 - 1190
IPKVSELIAKEDVDFLPYMSWQGEPQEAVRNQSLLASSEWPELRLSKRKHRKIPFSKRKMELSQPEVSED   1191 - 1260
FEEDGLGVLPAFTSNLERGGVEKLLDLSWTESCKPTATEPLFKKVSPWETSTSSFFPILAPAVGSYLPPT   1261 - 1330
ARAHSPASLSFASYRQVASFGSAAPPRQFDASQFSQGPVPGTCADWIPQSASCPTGPPQNPPSSPYCGIV   1331 - 1400
FSGSSLSSAQSAPLQHPGGFTTRPSAGTFPELDSPQLHFSLPTDPDPIRGFGSYHPSASSPFHFQPSAAS   1401 - 1470
LTANLRLPMASALPEALCSQSRTTPVDLCLLEESVGSLEGSRCPVFAFQSSDTESDELSEVLQDSCFLQI   1471 - 1540
KCDTKDDSILCFLEVKEEDEIVCIQHWQDAVPWTELLSLQTEDGFWKLTPELGLILNLNTNGLHSFLKQK   1541 - 1610
GIQSLGVKGRECLLDLIATMLVLQFIRTRLEKEGIVFKSLMKMDDASISRNIPWAFEAIKQASEWVRRTE   1611 - 1680
GQYPSICPRLELGNDWDSATKQLLGLQPISTVSPLHRVLHYSQG                             1681 - 1724
//

Text Mined References (39)

PMID Year Title
26699384 2016 Germline PARP4 mutations in patients with primary thyroid and breast cancers.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23739867 2013 Expression profiles of vault components MVP, TEP1 and vPARP and their correlation to other multidrug resistance proteins in ovarian cancer.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22190034 2011 Global landscape of HIV-human protein complexes.
21658281 2011 GWAS for discovery and replication of genetic loci associated with sudden cardiac arrest in patients with coronary artery disease.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20106667 2010 Toward a unified nomenclature for mammalian ADP-ribosyltransferases.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19536092 2009 Explorative study to identify novel candidate genes related to oxaliplatin efficacy and toxicity using a DNA repair array.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17203305 2007 Genetic variation in the base excision repair pathway and bladder cancer risk.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15169895 2004 Vault poly(ADP-ribose) polymerase is associated with mammalian telomerase and is dispensable for telomerase function and vault structure in vivo.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12829019 2003 PARP-1, a determinant of cell survival in response to DNA damage.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12140175 2002 Inhibition of poly(ADP-ribose) polymerase activation attenuates beta-lapachone-induced necrotic cell death in human osteosarcoma cells.
12123754 2002 GPI 6150, a PARP inhibitor, reduces the colon injury caused by dinitrobenzene sulfonic acid in the rat.
12101391 2002 Poly(ADP-ribose) polymerase-1 cleavage during apoptosis: an update.
11855821 2002 Structural domains of vault proteins: a role for the coiled coil domain in vault assembly.
11479319 2001 Multiple human vault RNAs. Expression and association with the vault complex.
11291045 2001 Up-regulation of vaults may be necessary but not sufficient for multidrug resistance.
10644454 1999 Identification of a novel gene (ADPRTL1) encoding a potential Poly(ADP-ribosyl)transferase protein.
10551828 1999 Vaults and telomerase share a common subunit, TEP1.
10477748 1999 The 193-kD vault protein, VPARP, is a novel poly(ADP-ribose) polymerase.
10100603 1999 The nuclear protein PH5P of the inter-alpha-inhibitor superfamily: a missing link between poly(ADP-ribose)polymerase and the inter-alpha-inhibitor family and a novel actor of DNA repair?
8724849 1996 Prediction of the coding sequences of unidentified human genes. V. The coding sequences of 40 new genes (KIAA0161-KIAA0200) deduced by analysis of cDNA clones from human cell line KG-1.
7937745 1994 Construction and characterization of a normalized cDNA library.