Property Summary

NCBI Gene PubMed Count 22
PubMed Score 37.29
PubTator Score 21.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.100 6.4e-04
inflammatory breast cancer -1.200 2.3e-05

Gene RIF (14)

PMID Text
26040766 we found that PARP3 interacted with FoxM1 to enhance its transcriptional activity and conferred glioblastoma cell radioresistance. Thus, our data suggest that PARP3 could be a therapeutic target to overcome radioresistance in glioblastoma
25800440 Identification of ADP-ribosylation sites in PARP3 and the determination of the extent ofpoly(ADP-ribosyl)ated residues in this protein was performed.
25255219 MiR-630 reduced apoptosis by downregulating several apoptotic modulators, PARP3, DDIT4, and EP300.
24598253 PARP3 likely facilitates the recruitment of Ku80 to double strand breaks to antagonize DNA end resection but facilitate Ku-mediated accurate classical non-homologous end-joining.
24528514 In some cancer cells, repression of PARP3 could be responsible for an increased telomerase activity.
21270334 PARP3 is a critical player in the stabilization of the mitotic spindle and in telomere integrity by associating and regulating the mitotic components NuMA and tankyrase 1.
21264220 PARP3 gene occupancy in the human neuroblastoma cell line SK-N-SH occurs preferentially with developmental genes regulating cell fate specification, tissue patterning, craniofacial development and neurogenesis.
21211721 PARP-3 has a role in chromosomal DNA double-strand break repair.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20064938 the interaction between PARP-1 and PARP-3 is unrelated to DNA single-strand break repair
19913121 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
17203305 Observational study of gene-disease association. (HuGE Navigator)
16924674 PARP-3 is a nuclear protein involved in transcriptional silencing and in the cellular response to DNA damage

AA Sequence

MAPKPKPWVQTEGPEKKKGRQAGREEDPFRSTAEALKAIPAEKRIIRVDPTCPLSSNPGTQVYEDYNCTL      1 - 70
NQTNIENNNNKFYIIQLLQDSNRFFTCWNHWGRVGEVGQSKINHFTRLEDAKKDFEKKFREKTKNNWAER     71 - 140
DHFVSHPGKYTLIEVQAEDEAQEAVVKVDRGPVRTVTKRVQPCSLDPATQKLITNIFSKEMFKNTMALMD    141 - 210
LDVKKMPLGKLSKQQIARGFEALEALEEALKGPTDGGQSLEELSSHFYTVIPHNFGHSQPPPINSPELLQ    211 - 280
AKKDMLLVLADIELAQALQAVSEQEKTVEEVPHPLDRDYQLLKCQLQLLDSGAPEYKVIQTYLEQTGSNH    281 - 350
RCPTLQHIWKVNQEGEEDRFQAHSKLGNRKLLWHGTNMAVVAAILTSGLRIMPHSGGRVGKGIYFASENS    351 - 420
KSAGYVIGMKCGAHHVGYMFLGEVALGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQ    421 - 490
QVVVPQGQPVPCPEFSSSTFSQSEYLIYQESQCRLRYLLEVHL                               491 - 533
//

Text Mined References (25)

PMID Year Title
26040766 2015 PARP3 interacts with FoxM1 to confer glioblastoma cell radioresistance.
25800440 2015 Quantitative site-specific ADP-ribosylation profiling of DNA-dependent PARPs.
25255219 2014 MiR-630 inhibits proliferation by targeting CDC7 kinase, but maintains the apoptotic balance by targeting multiple modulators in human lung cancer A549 cells.
24598253 2014 PARP3 affects the relative contribution of homologous recombination and nonhomologous end-joining pathways.
24528514 2014 Poly (ADP-ribose) polymerase 3 (PARP3), a potential repressor of telomerase activity.
21270334 2011 Poly(ADP-ribose) polymerase 3 (PARP3), a newcomer in cellular response to DNA damage and mitotic progression.
21264220 2011 A key role for poly(ADP-ribose) polymerase 3 in ectodermal specification and neural crest development.
21211721 2011 PARP-3 and APLF function together to accelerate nonhomologous end-joining.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20106667 2010 Toward a unified nomenclature for mammalian ADP-ribosyltransferases.
20064938 2010 PARP-3 is a mono-ADP-ribosylase that activates PARP-1 in the absence of DNA.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17203305 2007 Genetic variation in the base excision repair pathway and bladder cancer risk.
16924674 2007 PARP-3 associates with polycomb group bodies and with components of the DNA damage repair machinery.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12640039 2003 PARP-3 localizes preferentially to the daughter centriole and interferes with the G1/S cell cycle progression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10329013 1999 A human poly(ADP-ribose) polymerase gene family (ADPRTL): cDNA cloning of two novel poly(ADP-ribose) polymerase homologues.
7260241 1980 Oscillations of redox states in synchronously dividing cultures of Acanthamoeba castellanii and Schizosaccharomyces pombe.