Property Summary

Ligand Count 73
NCBI Gene PubMed Count 40
PubMed Score 95.23
PubTator Score 66.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.300 2.9e-04
atypical teratoid / rhabdoid tumor -1.300 4.8e-05
glioblastoma -1.300 1.7e-03
lung cancer 1.400 8.3e-03
medulloblastoma, large-cell -1.400 5.2e-06
ovarian cancer 1.200 1.3e-05
psoriasis -1.200 1.7e-03
subependymal giant cell astrocytoma -1.056 1.1e-02

Gene RIF (27)

AA Sequence

MAARRRRSTGGGRARALNESKRVNNGNTAPEDSSPAKKTRRCQRQESKKMPVAGGKANKDRTEDKQDGMP      1 - 70
GRSWASKRVSESVKALLLKGKAPVDPECTAKVGKAHVYCEGNDVYDVMLNQTNLQFNNNKYYLIQLLEDD     71 - 140
AQRNFSVWMRWGRVGKMGQHSLVACSGNLNKAKEIFQKKFLDKTKNNWEDREKFEKVPGKYDMLQMDYAT    141 - 210
NTQDEEETKKEESLKSPLKPESQLDLRVQELIKLICNVQAMEEMMMEMKYNTKKAPLGKLTVAQIKAGYQ    211 - 280
SLKKIEDCIRAGQHGRALMEACNEFYTRIPHDFGLRTPPLIRTQKELSEKIQLLEALGDIEIAIKLVKTE    281 - 350
LQSPEHPLDQHYRNLHCALRPLDHESYEFKVISQYLQSTHAPTHSDYTMTLLDLFEVEKDGEKEAFREDL    351 - 420
HNRMLLWHGSRMSNWVGILSHGLRIAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEV    421 - 490
ALGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGSTVPLGPASDTGILNPDGYTLNYNEYI    491 - 560
VYNPNQVRMRYLLKVQFNFLQLW                                                   561 - 583
//

Text Mined References (43)

PMID Year Title