Property Summary

NCBI Gene PubMed Count 19
PubMed Score 10.92
PubTator Score 6.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma -2.500 8.9e-03
ependymoma -1.800 4.2e-02
oligodendroglioma -2.100 4.0e-02
glioblastoma -3.000 2.3e-04
medulloblastoma -2.700 3.7e-03
periodontitis 1.100 1.1e-14
atypical teratoid / rhabdoid tumor -3.400 5.6e-07
medulloblastoma, large-cell -3.600 1.3e-03
primitive neuroectodermal tumor -3.500 7.3e-05
adrenocortical adenoma -1.050 1.4e-02
adrenocortical carcinoma -1.827 8.9e-03
non-small cell lung cancer -1.983 2.9e-12
intraductal papillary-mucinous neoplasm ... 1.100 3.7e-02
lung cancer -2.900 6.1e-06
breast carcinoma -1.300 3.7e-05
diabetes mellitus -1.100 8.1e-03
adult high grade glioma -2.200 1.4e-02
pilocytic astrocytoma -1.800 5.5e-03
lung adenocarcinoma -1.300 9.5e-04
lung carcinoma -1.400 3.0e-06
Pick disease -1.500 3.5e-02
ovarian cancer -1.900 1.3e-11

Gene RIF (4)

PMID Text
23902727 Our results strongly suggest the oncogenic potential of PARM-1.
22766399 PARM1 does not play a major role in the development of epispadias
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18027867 Ectopic expression of hPARM-1 in PC3 prostate cancer cells increased colony formation, suggesting a probable role in cell proliferation.

AA Sequence

MVYKTLFALCILTAGWRVQSLPTSAPLSVSLPTNIVPPTTIWTSSPQNTDADTASPSNGTHNNSVLPVTA      1 - 70
SAPTSLLPKNISIESREEEITSPGSNWEGTNTDPSPSGFSSTSGGVHLTTTLEEHSSGTPEAGVAATLSQ     71 - 140
SAAEPPTLISPQAPASSPSSLSTSPPEVFSASVTTNHSSTVTSTQPTGAPTAPESPTEESSSDHTPTSHA    141 - 210
TAEPVPQEKTPPTTVSGKVMCELIDMETTTTFPRVIMQEVEHALSSGSIAAITVTVIAVVLLVFGVAAYL    211 - 280
KIRHSSYGRLLDDHDYGSWGNYNNPLYDDS                                            281 - 310
//

Text Mined References (20)

PMID Year Title
23902727 2013 Characterization and identification of PARM-1 as a new potential oncogene.
22766399 2012 Murine expression and mutation analyses of the prostate androgen-regulated mucin-like protein 1 (Parm1) gene, a candidate for human epispadias.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18027867 2008 Human PARM-1 is a novel mucin-like, androgen-regulated gene exhibiting proliferative effects in prostate cancer cells.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15466293 2004 High-content screening microscopy identifies novel proteins with a putative role in secretory membrane traffic.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12772192 2003 Prostatic androgen repressed message-1 (PARM-1) may play a role in prostatic cell immortalisation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10499539 1999 A novel gene overexpressed in the prostate of castrated rats: hormonal regulation, relationship to apoptosis and to acquired prostatic cell androgen independence.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.