Property Summary

NCBI Gene PubMed Count 328
PubMed Score 835.46
PubTator Score 581.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus -1.900 9.6e-03
Multiple myeloma 1.489 1.1e-04
ovarian cancer 1.100 3.5e-02
pancreatic ductal adenocarcinoma liver m... -1.154 4.9e-02
Waldenstrons macroglobulinemia 1.203 2.8e-03

Synonym

Accession Q99497 B2R4Z1 O14805 Q6DR95 Q7LFU2
Symbols DJ1
DJ-1
GATD2
HEL-S-67p

Gene

PDB (45)

Gene RIF (295)

AA Sequence

MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVV      1 - 70
VLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYT     71 - 140
YSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD                         141 - 189
//

Text Mined References (332)

PMID Year Title