Property Summary

NCBI Gene PubMed Count 632
PubMed Score 1004.07
PubTator Score 567.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count P-value
psoriasis 6694 2.7e-102
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 0.0 1.3
pancreatic cancer 2398 0.0 0.9
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 2.7e-102

Protein-protein Interaction (7)

PDB (11)

Gene RIF (585)

AA Sequence

MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIV      1 - 70
QRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGR     71 - 140
SIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFF    141 - 210
KCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHD    211 - 280
PQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKV    281 - 350
TCEGGNGLGCGFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPR    351 - 420
CHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV                             421 - 465
//

Text Mined References (639)

PMID Year Title