Property Summary

NCBI Gene PubMed Count 44
PubMed Score 219.75
PubTator Score 141.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Borna disease 8 3.133 1.6
Cancer 2346 3.061 1.5

Expression

Gene RIF (27)

PMID Text
26091342 Studies indicate that poly (ADP-ribose) glycohydrolase (PARG) and terminal ADP-ribose glycohydrolase 1 (TARG1) are key enzymes in poly(ADP-ribose) polymerases (PARPs)-mediated ADP-ribosylation.
25535335 Poly(ADP-ribosyl) glycohydrolase (PARG) is involved in cell proliferation and DNA synthesis, with depletion leading to replication-coupled H2AX phosphorylation. In addition, PARG depletion or inhibition slows down individual replication forks similarly to mild chemotherapeutic treatment.
25133494 Nuclear Smad function is negatively regulated by PARP-1 that is assisted by PARP-2 and positively regulated by PARG during the course of TGFB signaling.
24211580 Radiation-induced G2/M arrest was largely suppressed by PARG siRNA in PC-14 and A427 cells, which exhibited significantly enhanced radiosensitivity in response to PARG knockdown.
23776710 poly(ADP-ribose) glycohydrolase is crucial for Trypanosoma cruzi infection cycle.
23744356 PARG knockdown enhances sensitivity to MMS in MIAPaCa2 and RKO tumor cell lines.
23467693 The amount of poly(ADP-ribose) in a cell is regulated under the control of PARP1/PARG gene expression balance.
23254695 Therefore, strategies that target PAR metabolism for the improved treatment of cancer may be required to target PARP-1 and PARG individually in order to optimize cancer cell death.
23102699 Results define PARG as a coactivator regulating chromatin remodeling during retinoic acid receptor-dependent gene expression.
22918473 PARG silencing could inhibit the ability of HUVEC migration and proliferation by downregulating the activity of NF-kappaB in LoVo cells that in turn decreases angiogenic factors such as VEGF, b-FGF, ICAM-1, MMP-9, as well as phosphorylation of p38 and ERK.
22839996 Silencing of Apoptosis-Inducing factor and poly(ADP-ribose) glycohydrolase reveals novel roles in breast cancer cell death after chemotherapy.
22508044 PARG knockdown, concomitant with inhibition of PARP, suppressed the metastatic potency of colon carcinoma cells by activation of PI3K/Akt signaling pathway.
22333589 inhibition of PARG leads to an accumulation of PAR polymers, the collapse of replication forks and the induction of homologous recombination in wild-type cells.
19812418 PARP-1 and PARG, nuclear enzymes with opposing enzymatic activities, localize to target promoters and act in a similar, rather than antagonistic, manner to regulate gene expression
19571039 These data indicate that PARG is a survival factor at mild oxidative damage but contributes to the apoptosis-necrosis switch in severely damaged cells.
19454480 PARG could be a novel potential therapeutic target for radiotherapy.
19389396 The identification of a PARG isoform as a component of the mitochondrial matrix raises several interesting possibilities concerning mechanisms of nuclear-mitochondrial cross talk involved in regulation of cell death pathways.
19076642 suggest that PU.1-binding motifs are essential for PARG promoter activity and that PU.1 modulates PARG gene expression during differentiation of HL-60 cells.
18636124 Observational study of gene-disease association. (HuGE Navigator)
18407589 PPAR gamma ligands inhibit growth and induce apoptosis of liver cancer cell
17548475 PARG is identified as a novel and critical component of single-strand break repair that accelerates this process in concert with PARP-1.
17509564 hPARG55, that can be expressed through alternative translation initiation from hPARG60 transcripts is strictly targeted to the mitochondria.
16526943 results suggest that PARG may play an autonomous role in the cellular response to oxidative DNA damage
16117724 PARG is resident in FMRP (Fragile-X mental retardation protein)-associated messenger ribonucleoparticles complexes.
15868399 PARG in modulating chromatin structure, participares in transcription, DNA repair and apoptosis [review].
15212953 PARG is expressed in alternatiuve splice variants yielding isoforms that localize to different cell compartments.
12878198 Subcellular localization of human poly(ADP-ribose) glycohydrolase in mammalian cells.

AA Sequence

MNAGPGCEPCTKRPRWGAATTSPAASDARSFPSRQRRVLDPKDAHVQFRVPPSSPACVPGRAGQHRGSAT      1 - 70
SLVFKQKTITSWMDTKGIKTAESESLDSKENNNTRIESMMSSVQKDNFYQHNVEKLENVSQLSLDKSPTE     71 - 140
KSTQYLNQHQTAAMCKWQNEGKHTEQLLESEPQTVTLVPEQFSNANIDRSPQNDDHSDTDSEENRDNQQF    141 - 210
LTTVKLANAKQTTEDEQAREAKSHQKCSKSCDPGEDCASCQQDEIDVVPESPLSDVGSEDVGTGPKNDNK    211 - 280
LTRQESCLGNSPPFEKESEPESPMDVDNSKNSCQDSEADEETSPGFDEQEDGSSSQTANKPSRFQARDAD    281 - 350
IEFRKRYSTKGGEVRLHFQFEGGESRTGMNDLNAKLPGNISSLNVECRNSKQHGKKDSKITDHFMRLPKA    351 - 420
EDRRKEQWETKHQRTERKIPKYVPPHLSPDKKWLGTPIEEMRRMPRCGIRLPLLRPSANHTVTIRVDLLR    421 - 490
AGEVPKPFPTHYKDLWDNKHVKMPCSEQNLYPVEDENGERTAGSRWELIQTALLNKFTRPQNLKDAILKY    491 - 560
NVAYSKKWDFTALIDFWDKVLEEAEAQHLYQSILPDMVKIALCLPNICTQPIPLLKQKMNHSITMSQEQI    561 - 630
ASLLANAFFCTFPRRNAKMKSEYSSYPDINFNRLFEGRSSRKPEKLKTLFCYFRRVTEKKPTGLVTFTRQ    631 - 700
SLEDFPEWERCEKPLTRLHVTYEGTIEENGQGMLQVDFANRFVGGGVTSAGLVQEEIRFLINPELIISRL    701 - 770
FTEVLDHNECLIITGTEQYSEYTGYAETYRWSRSHEDGSERDDWQRRCTEIVAIDALHFRRYLDQFVPEK    771 - 840
MRRELNKAYCGFLRPGVSSENLSAVATGNWGCGAFGGDARLKALIQILAAAAAERDVVYFTFGDSELMRD    841 - 910
IYSMHIFLTERKLTVGDVYKLLLRYYNEECRNCSTPGPDIKLYPFIYHAVESCAETADHSGQRTGT        911 - 976
//

Text Mined References (58)

PMID Year Title
27257257 2016 ADP-ribose-derived nuclear ATP synthesis by NUDIX5 is required for chromatin remodeling.
26091342 2015 Structures and Mechanisms of Enzymes Employed in the Synthesis and Degradation of PARP-Dependent Protein ADP-Ribosylation.
25535335 2015 Poly(ADP-ribosyl) glycohydrolase prevents the accumulation of unusual replication structures during unperturbed S phase.
25133494 2014 Fine-tuning of Smad protein function by poly(ADP-ribose) polymerases and poly(ADP-ribose) glycohydrolase during transforming growth factor ? signaling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24211580 2013 Silencing of poly(ADP-ribose) glycohydrolase sensitizes lung cancer cells to radiation through the abrogation of DNA damage checkpoint.
23776710 2013 Host cell poly(ADP-ribose) glycohydrolase is crucial for Trypanosoma cruzi infection cycle.
23744356 2013 PARG dysfunction enhances DNA double strand break formation in S-phase after alkylation DNA damage and augments different cell death pathways.
23467693 2013 PARP1 gene expression is downregulated by knockdown of PARG gene.
23254695 2013 Inhibition of poly(ADP-ribose) polymerase-1 or poly(ADP?ribose) glycohydrolase individually, but not in combination, leads to improved chemotherapeutic efficacy in HeLa cells.
23251397 2012 Structures of the human poly (ADP-ribose) glycohydrolase catalytic domain confirm catalytic mechanism and explain inhibition by ADP-HPD derivatives.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23102699 2012 Poly (ADP-ribose) glycohydrolase regulates retinoic acid receptor-mediated gene expression.
22918473 2012 Effect of silencing PARG in human colon carcinoma LoVo cells on the ability of HUVEC migration and proliferation.
22839996 2012 Silencing of Apoptosis-Inducing factor and poly(ADP-ribose) glycohydrolase reveals novel roles in breast cancer cell death after chemotherapy.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22508044 2012 RNA interference of PARG could inhibit the metastatic potency of colon carcinoma cells via PI3-kinase/Akt pathway.
22433848 2012 ADP-ribosylhydrolase 3 (ARH3), not poly(ADP-ribose) glycohydrolase (PARG) isoforms, is responsible for degradation of mitochondrial matrix-associated poly(ADP-ribose).
22333589 2012 Inhibition of poly(ADP-ribose) glycohydrolase (PARG) specifically kills BRCA2-deficient tumor cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21398629 2011 PARG is recruited to DNA damage sites through poly(ADP-ribose)- and PCNA-dependent mechanisms.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19812418 2009 Global analysis of transcriptional regulation by poly(ADP-ribose) polymerase-1 and poly(ADP-ribose) glycohydrolase in MCF-7 human breast cancer cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19571039 2009 Dual role of poly(ADP-ribose) glycohydrolase in the regulation of cell death in oxidatively stressed A549 cells.
19454480 2009 Radiation-induced mitotic catastrophe in PARG-deficient cells.
19389396 2009 A specific isoform of poly(ADP-ribose) glycohydrolase is targeted to the mitochondrial matrix by a N-terminal mitochondrial targeting sequence.
19105632 2009 Proteomic investigation of phosphorylation sites in poly(ADP-ribose) polymerase-1 and poly(ADP-ribose) glycohydrolase.
19076642 2008 Characterization of the promoter region of the human PARG gene and its response to PU.1 during differentiation of HL-60 cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18407589 2008 Troglitazone, a peroxisome proliferator-activated receptor gamma ligand, induces growth inhibition and apoptosis of HepG2 human liver cancer cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17548475 2007 Poly(ADP-ribose) polymerase 1 accelerates single-strand break repair in concert with poly(ADP-ribose) glycohydrolase.
17509564 2007 Two small enzyme isoforms mediate mammalian mitochondrial poly(ADP-ribose) glycohydrolase (PARG) activity.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16963444 2006 MNNG-induced cell death is controlled by interactions between PARP-1, poly(ADP-ribose) glycohydrolase, and XRCC1.
16526943 2006 Poly(ADP-ribose) glycohydrolase silencing protects against H2O2-induced cell death.
16460818 2006 Dynamic relocation of poly(ADP-ribose) glycohydrolase isoforms during radiation-induced DNA damage.
16117724 2005 Poly(ADP-ribose) glycohydrolase is a component of the FMRP-associated messenger ribonucleoparticles.
15868399 2005 Regulation of poly(ADP-ribose) metabolism by poly(ADP-ribose) glycohydrolase: where and when?
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15450800 2004 A nonradiometric, high-throughput assay for poly(ADP-ribose) glycohydrolase (PARG): application to inhibitor identification and evaluation.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15212953 2004 Human poly(ADP-ribose) glycohydrolase is expressed in alternative splice variants yielding isoforms that localize to different cell compartments.
15081900 2004 Tannins elevate the level of poly(ADP-ribose) in HeLa cell extracts.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14622405 2003 ParG, a protein required for active partition of bacterial plasmids, has a dimeric ribbon-helix-helix structure.
14527731 2003 Human poly(ADP-ribose) glycohydrolase (PARG) gene and the common promoter sequence it shares with inner mitochondrial membrane translocase 23 (TIM23).
12878198 2003 Subcellular localization of poly(ADP-ribose) glycohydrolase in mammalian cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11053413 2001 Caspase-3-mediated processing of poly(ADP-ribose) glycohydrolase during apoptosis.
10449915 1999 Assignment of the poly(ADP-ribose) glycohydrolase gene (PARG) to human chromosome 10q11.23 and mouse chromosome 14B by in situ hybridization.
9925755 1999 Poly(ADP-ribose) glycohydrolase is present and active in mammalian cells as a 110-kDa protein.
9115250 1997 Isolation and characterization of the cDNA encoding bovine poly(ADP-ribose) glycohydrolase.
9074616 1997 Analysis of poly(ADP-ribose) glycohydrolase activity in nuclear extracts from mammalian cells.
8428996 1993 Preferential degradation of protein-bound (ADP-ribose)n by nuclear poly(ADP-ribose) glycohydrolase from human placenta.