Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.62
PubTator Score 2.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma 1.026 4.3e-02
posterior fossa group B ependymoma 1.300 1.2e-06
glioblastoma 1.100 1.5e-06
sonic hedgehog group medulloblastoma 2.000 3.6e-08
cystic fibrosis 1.318 1.0e-04
atypical teratoid / rhabdoid tumor 1.300 3.6e-06
medulloblastoma, large-cell 1.300 1.4e-02
primitive neuroectodermal tumor 1.700 3.4e-05
tuberculosis -1.500 1.7e-04
non-small cell lung cancer 1.286 1.2e-08
interstitial cystitis -1.600 2.2e-05
pilocytic astrocytoma 1.400 5.4e-07

Gene RIF (4)

PMID Text
26073086 This paper shows Par6G as a negative regulator of the phosphatidylinositol 3'-kinase/phosphoinositide-dependent protein kinase 1/Akt pathway and epithelial cell proliferation and evidence for frequent inactivation of Par6G gene in epithelial cancers.
23333304 HIV-1 Vif modulates the expression of par-6 family cell polarity regulator gamma (PARD6G) in Vif-expression T cells
23264737 this study is the first to identify Par6gamma as a component of the mother centriole and to report a role of a mother centriole protein in the regulation of centrosomal protein composition.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MNRSFHKSQTLRFYDCSAVEVKSKFGAEFRRFSLDRHKPGKFEDFYKLVVHTHHISNSDVTIGYADVHGD      1 - 70
LLPINNDDNFCKAVSSANPLLRVFIQKREEAERGSLGAGSLCRRRRALGALRDEGPRRRAHLDIGLPRDF     71 - 140
RPVSSIIDVDLVPETHRRVRLHRHGCEKPLGFYIRDGASVRVTPHGLEKVPGIFISRMVPGGLAESTGLL    141 - 210
AVNDEVLEVNGIEVAGKTLDQVTDMMIANSHNLIVTVKPANQRNNVVRGGRALGSSGPPSDGTAGFVGPP    211 - 280
APRVLQNFHPDEAESDEDNDVVIEGTLEPARPPQTPGAPAGSLSRVNGAGLAQRLQRDLALDGGLQRLLS    281 - 350
SLRADPRHSLALPPGGVEEHGPAVTL                                                351 - 376
//

Text Mined References (14)

PMID Year Title
26073086 2016 Par6G suppresses cell proliferation and is targeted by loss-of-function mutations in multiple cancers.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
23264737 2013 Par6? is at the mother centriole and controls centrosomal protein composition through a Par6?-dependent pathway.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17057644 2006 A distinct PAR complex associates physically with VE-cadherin in vertebrate endothelial cells.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676191 2004 Comprehensive proteomic analysis of human Par protein complexes reveals an interconnected protein network.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12459187 2002 PAR3beta, a novel homologue of the cell polarity protein PAR3, localizes to tight junctions.
11260256 2001 Human homologues of the Caenorhabditis elegans cell polarity protein PAR6 as an adaptor that links the small GTPases Rac and Cdc42 to atypical protein kinase C.
11257119 2001 Atypical protein kinase C is involved in the evolutionarily conserved par protein complex and plays a critical role in establishing epithelia-specific junctional structures.
10934474 2000 The cell-polarity protein Par6 links Par3 and atypical protein kinase C to Cdc42.