Property Summary

NCBI Gene PubMed Count 26
PubMed Score 5.86
PubTator Score 7.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
interstitial lung disease -2.000 5.9e-03
non-small cell lung cancer -1.838 1.2e-16
intraductal papillary-mucinous neoplasm ... 2.100 1.3e-02
lung cancer -2.700 1.5e-04
pancreatic cancer 1.100 1.3e-04
breast carcinoma 2.100 7.7e-05
interstitial cystitis -1.700 1.2e-04
atypical teratoid/rhabdoid tumor 1.800 5.4e-03
posterior fossa group B ependymoma 1.300 1.3e-03
lung carcinoma -1.400 7.1e-22
ductal carcinoma in situ 1.400 2.1e-02
invasive ductal carcinoma 2.100 4.6e-02
ovarian cancer 1.700 2.8e-03

Protein-protein Interaction (12)

Gene RIF (6)

PMID Text
26526116 found that the polarity determinants Cdc42, Par6B, PKCzeta/iota and the structural proteins ezrin and phospho-ezrin were lost from the apical membrane and accumulated either in the cytoplasm or on the basal side of enterocytes in patients
25662318 PAK4 phosphorylates Par6B at Ser143 blocking its interaction with Cdc42.
21300793 Data conclude that Par6B and aPKC control mitotic spindle orientation in polarized epithelia and, furthermore, that aPKC coordinately regulates multiple processes to promote morphogenesis.
20631255 This study demonstrates that controlled regulation of PAK4 is required for apical junction formation in lung epithelial cells and highlights potential cross-talk between two Cdc42 targets, PAK4 and Par6B.
19401335 Interaction between PAR-3 and the aPKC-PAR-6 complex is indispensable for apical domain development of epithelial cells.
15677324 The ability of SRC family coactivators to regulate the expression of one of these genes, PARD6B/Par6, was confirmed by using cells individually depleted of SRC-1.

AA Sequence

MNRSHRHGAGSGCLGTMEVKSKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLVGYADIHGDLL      1 - 70
PINNDDNYHKAVSTANPLLRIFIQKKEEADYSAFGTDTLIKKKNVLTNVLRPDNHRKKPHIVISMPQDFR     71 - 140
PVSSIIDVDILPETHRRVRLYKYGTEKPLGFYIRDGSSVRVTPHGLEKVPGIFISRLVPGGLAQSTGLLA    141 - 210
VNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRNNVVRNSRTSGSSGQSTDNSLLGYPQQI    211 - 280
EPSFEPEDEDSEEDDIIIEDNGVPQQIPKAVPNTESLESLTQIELSFESGQNGFIPSNEVSLAAIASSSN    281 - 350
TEFETHAPDQKLLEEDGTIITL                                                    351 - 372
//

Text Mined References (28)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26526116 2016 The localisation of the apical Par/Cdc42 polarity module is specifically affected in microvillus inclusion disease.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25662318 2015 Functional cross-talk between Cdc42 and two downstream targets, Par6B and PAK4.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21771265 2011 Genome-wide association study on bipolar disorder in the Bulgarian population.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21300793 2011 Par6B and atypical PKC regulate mitotic spindle orientation during epithelial morphogenesis.
20936779 2010 A human MAP kinase interactome.
20631255 2010 Cdc42 regulates apical junction formation in human bronchial epithelial cells through PAK4 and Par6B.
19401335 2009 Interaction between PAR-3 and the aPKC-PAR-6 complex is indispensable for apical domain development of epithelial cells.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15677324 2005 Identification of target genes in breast cancer cells directly regulated by the SRC-3/AIB1 coactivator.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15254234 2004 Nucleotide exchange factor ECT2 interacts with the polarity protein complex Par6/Par3/protein kinase Czeta (PKCzeta) and regulates PKCzeta activity.
14676191 2004 Comprehensive proteomic analysis of human Par protein complexes reveals an interconnected protein network.
12725730 2003 Mammalian Lgl forms a protein complex with PAR-6 and aPKC independently of PAR-3 to regulate epithelial cell polarity.
12545177 2003 Direct interaction of two polarity complexes implicated in epithelial tight junction assembly.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12459187 2002 PAR3beta, a novel homologue of the cell polarity protein PAR3, localizes to tight junctions.
12234671 2002 Multiple splice variants of Par3 and of a novel related gene, Par3L, produce proteins with different binding properties.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11260256 2001 Human homologues of the Caenorhabditis elegans cell polarity protein PAR6 as an adaptor that links the small GTPases Rac and Cdc42 to atypical protein kinase C.
10934474 2000 The cell-polarity protein Par6 links Par3 and atypical protein kinase C to Cdc42.