Property Summary

NCBI Gene PubMed Count 51
PubMed Score 9.52
PubTator Score 26.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
posterior fossa group A ependymoma -1.200 2.3e-08
glioblastoma -1.700 8.6e-06
astrocytoma -1.100 1.9e-02
atypical teratoid / rhabdoid tumor -1.200 2.6e-06
medulloblastoma, large-cell -1.300 1.3e-04
pediatric high grade glioma -1.600 4.1e-07
pilocytic astrocytoma -1.300 5.4e-07
subependymal giant cell astrocytoma -1.093 2.4e-02

Protein-protein Interaction (6)

Gene RIF (26)

PMID Text
26050620 Shp2 promotes metastasis of prostate cancer by attenuating the PAR3/PAR6/aPKC polarity protein complex and enhancing epithelial-to-mesenchymal transition
25756394 TGFbeta induced Par6 phosphorylation on Ser345 and its recruitment to the leading edge of the membrane ruffle in migrating PC-3U cells, where it colocalised with aPKCzeta. The p-Par6-aPKCzeta complex is important for cell migration and invasion.
23762244 BDNF can regulate formation of functional synapses by increasing the expression of the RhoA inhibitors, Par6C and Rnd3.
23439680 Morg1 facilitates Par6-aPKC binding to Crb3 for definition of apical identity of epithelial cells.
23341197 Par6 negatively regulates trophoblast fusion via its roles on tight junctions and cytoskeleton dynamics and provide novel insight into the contribution of this polarity marker in altered trophoblast cell fusion typical of preeclampsia.
23249950 Atypical protein kinase C kinase activity, as well as an association with PAR6, were found to be important for PAR6 phosphorylation.
22339630 Pak6 is a binding partner and a outatuve effector protein for the atypical rho GTPase cdc42 homologous protein.
21549621 Data indicate that both tumor focality and Par3/Par6/atypical protein kinase C (APKC) expression were significantly associated with tumor recurrence.
21170030 Data show that DDR1 coordinates the Par3/Par6 cell-polarity complex through its carboxy terminus, binding PDZ domains in Par3 and Par6.
20719959 Par6alpha controls centrosome organization through its association with the dynactin subunit p150(Glued).
19667198 the TGFbeta-Par6 polarity pathway has a role in breast cancer progression
19617897 Ect2 and PKCiota are genetically and functionally linked in NSCLC, acting to coordinately drive tumor cell proliferation and invasion through formation of an oncogenic PKCiota-Par6alpha-Ect2 complex.
18922891 in addition to regulating cell polarization processes, Par6 is an inducer of cell proliferation in breast epithelial cells.
18562307 Neph1-Nephrin proteins bind the Par3-Par6-atypical protein kinase C (aPKC) complex to regulate podocyte cell polarity
17976838 In vivo binding studies identified a novel mechanism of Par6 interaction, suggesting that the cell polarity machinery may serve to spatially restrict Rit signaling.
17586613 Shear stress-induced directed migratory polarity is modulated by exogenous growth factors and dependent on Par6 activity and shear stress direction in endothelial cells
17560945 Knockdown of par-6 family cell polarity regulator alpha (PARD6A) by siRNAs significantly enhances HIV-1 replication in human acute monocytic leukemia cells
17420281 Par6 was characterized as a dual-location protein.
17335965 Par6alpha-mediated inhibition of insulin-dependent glycogen synthesis in C2C12 cells depends on the direct interaction of Par6alpha with aPKC and on aPKC-mediated T34 phosphorylation of Akt1.
17057644 We provide evidence for the existence of a distinct PAR protein complex in endothelial cells. Both PAR-3 and PAR-6 associate directly with the adherens junction protein vascular endothelial cadherin (VE-cadherin).
17050699 Studies in this review confirm that signaling by Par6alpha controls the migration of immature granule neurons down the Bergmann glial fibers into the internal granule cell layer in which they establish synaptic connections.
15782111 findings demonstrated that G-protein-activated phospholipase C-beta interacts with cell polarity proteins Par3 and Par6 to form protein complexes and to mediate downstream signal transduction
15744531 Observational study of gene-disease association. (HuGE Navigator)
15744531 A rare A/G polymorphism in the promoter of the Par6alpha gene is associated with reduced fasting glycaemia, increased glucose tolerance and reduced serum nonesterified fatty Acids concentrations.
15590654 crystal structure of the complex of PKCiota and Par6alpha PB1 domains to a resolution of 1.5 A
14976222 Partitioning-defective protein 6 associated constitutively with endogenous aPKCs.

AA Sequence

MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVHQIPGLDVLLGYTDAHGDLLP      1 - 70
LTNDDSLHRALASGPPPLRLLVQKRAEADSSGLAFASNSLQRRKKGLLLRPVAPLRTRPPLLISLPQDFR     71 - 140
QVSSVIDVDLLPETHRRVRLHKHGSDRPLGFYIRDGMSVRVAPQGLERVPGIFISRLVRGGLAESTGLLA    141 - 210
VSDEILEVNGIEVAGKTLDQVTDMMVANSHNLIVTVKPANQRNNVVRGASGRLTGPPSAGPGPAEPDSDD    211 - 280
DSSDLVIENRQPPSSNGLSQGPPCWDLHPGCRHPGTRSSLPSLDDQEQASSGWGSRIRGDGSGFSL        281 - 346
//

Text Mined References (55)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26050620 2016 Shp2 promotes metastasis of prostate cancer by attenuating the PAR3/PAR6/aPKC polarity protein complex and enhancing epithelial-to-mesenchymal transition.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25756394 2015 TGF?-induced phosphorylation of Par6 promotes migration and invasion in prostate cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23762244 2013 A genome-wide screen of CREB occupancy identifies the RhoA inhibitors Par6C and Rnd3 as regulators of BDNF-induced synaptogenesis.
23439680 2013 The WD40 protein Morg1 facilitates Par6-aPKC binding to Crb3 for apical identity in epithelial cells.
23341197 2013 Where polarity meets fusion: role of Par6 in trophoblast differentiation during placental development and preeclampsia.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23249950 2013 Atypical protein kinase C phosphorylates Par6 and facilitates transforming growth factor ?-induced epithelial-to-mesenchymal transition.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22339630 2012 Pak6 protein kinase is a novel effector of an atypical Rho family GTPase Chp/RhoV.
21549621 2013 Loss of APKC expression independently predicts tumor recurrence in superficial bladder cancers.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21170030 2011 Collective cell migration requires suppression of actomyosin at cell-cell contacts mediated by DDR1 and the cell polarity regulators Par3 and Par6.
20719959 2010 Par6 alpha interacts with the dynactin subunit p150 Glued and is a critical regulator of centrosomal protein recruitment.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19667198 2009 A role for the TGFbeta-Par6 polarity pathway in breast cancer progression.
19617897 2009 Ect2 links the PKCiota-Par6alpha complex to Rac1 activation and cellular transformation.
19379695 2009 Regulation of planar cell polarity by Smurf ubiquitin ligases.
18922891 2008 The polarity protein Par6 induces cell proliferation and is overexpressed in breast cancer.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18562307 2008 Neph-Nephrin proteins bind the Par3-Par6-atypical protein kinase C (aPKC) complex to regulate podocyte cell polarity.
17976838 2007 Rit mutants confirm role of MEK/ERK signaling in neuronal differentiation and reveal novel Par6 interaction.
17586613 2007 Arterial shear stress regulates endothelial cell-directed migration, polarity, and morphology in confluent monolayers.
17420281 2007 Characterization of mammalian Par 6 as a dual-location protein.
17350623 2007 PKCzetaII is a target for degradation through the tumour suppressor protein pVHL.
17335965 2007 The Par6alpha/aPKC complex regulates Akt1 activity by phosphorylating Thr34 in the PH-domain.
17057644 2006 A distinct PAR complex associates physically with VE-cadherin in vertebrate endothelial cells.
17050699 2006 mPar6 alpha controls neuronal migration.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15831491 2005 Small GTPase proteins Rin and Rit Bind to PAR6 GTP-dependently and regulate cell transformation.
15782111 2005 G-protein-activated phospholipase C-beta, new partners for cell polarity proteins Par3 and Par6.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15761148 2005 Regulation of the polarity protein Par6 by TGFbeta receptors controls epithelial cell plasticity.
15744531 2005 A novel functional polymorphism (-336A/G) in the promoter of the partitioning-defective protein-6alpha gene is associated with increased glucose tolerance and lower concentrations of serum non-esterified fatty acids.
15590654 2005 Structure of a cell polarity regulator, a complex between atypical PKC and Par6 PB1 domains.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15254234 2004 Nucleotide exchange factor ECT2 interacts with the polarity protein complex Par6/Par3/protein kinase Czeta (PKCzeta) and regulates PKCzeta activity.
14976222 2004 Partitioning-defective protein 6 regulates insulin-dependent glycogen synthesis via atypical protein kinase C.
14718572 2004 CRB3 binds directly to Par6 and regulates the morphogenesis of the tight junctions in mammalian epithelial cells.
14676191 2004 Comprehensive proteomic analysis of human Par protein complexes reveals an interconnected protein network.
12545177 2003 Direct interaction of two polarity complexes implicated in epithelial tight junction assembly.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12459187 2002 PAR3beta, a novel homologue of the cell polarity protein PAR3, localizes to tight junctions.
11260256 2001 Human homologues of the Caenorhabditis elegans cell polarity protein PAR6 as an adaptor that links the small GTPases Rac and Cdc42 to atypical protein kinase C.
11257119 2001 Atypical protein kinase C is involved in the evolutionarily conserved par protein complex and plays a critical role in establishing epithelia-specific junctional structures.
10954424 2000 The mammalian homologue of the Caenorhabditis elegans polarity protein PAR-6 is a binding partner for the Rho GTPases Cdc42 and Rac1.
10934474 2000 The cell-polarity protein Par6 links Par3 and atypical protein kinase C to Cdc42.
10873802 2000 A human homolog of the C. elegans polarity determinant Par-6 links Rac and Cdc42 to PKCzeta signaling and cell transformation.
9482110 1998 The C-terminus of the HTLV-1 Tax oncoprotein mediates interaction with the PDZ domain of cellular proteins.