Property Summary

NCBI Gene PubMed Count 86
PubMed Score 196.08
PubTator Score 138.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma 1.400 1.1e-06
psoriasis -1.500 1.2e-03
cutaneous lupus erythematosus -1.800 3.4e-03
osteosarcoma 1.365 8.7e-03
medulloblastoma 1.500 5.3e-05
astrocytoma 1.500 1.0e-02
atypical teratoid / rhabdoid tumor 1.500 2.1e-07
glioblastoma 1.300 9.4e-05
primitive neuroectodermal tumor 1.300 3.6e-03
non-small cell lung cancer 1.123 5.7e-11
intraductal papillary-mucinous carcinoma... 1.200 5.5e-03
interstitial cystitis -1.500 3.9e-04
pediatric high grade glioma 1.100 1.3e-03
breast carcinoma -1.200 1.7e-32
spina bifida -1.914 4.7e-02
Pick disease 1.300 1.7e-03
Breast cancer -1.500 9.3e-13
ovarian cancer -1.500 1.2e-06

Protein-protein Interaction (4)

Gene RIF (44)

PMID Text
26589794 Knockdown of the polarity protein Par3 reversed the effects of Galpha13 knockdown on cell-cell adhesion and proteolytic invasion in three-dimensional collagen.
26116754 study indicated a potential molecular basis for cell growth-promoting function of PARD3 by modulating the Hippo pathway signaling in response to cell contact and cell polarity signals
26050620 Shp2 promotes metastasis of prostate cancer by attenuating the PAR3/PAR6/aPKC polarity protein complex and enhancing epithelial-to-mesenchymal transition
25833829 PAR3-mutant proteins exhibit a relative reduction in the ability to mediate formation of tight junctions and actin-based protrusions and activate STAT3 at cell confluence.
25820151 Par-3 plays an important role in the modulation of intestinal barrier function by regulating delivery of occludin as well as suppression of MLC phosphorylation.
25518939 PAR3 and aPKC control the organization of the Golgi through CLASP2 phosphorylation.
24856572 A cytoplasmic expression of PAR-3 is therefore implicated in worse clinical and pathological cancer features in clear cell renal cell carcinoma and could be useful to identify patients with high-risk tumors.
24243103 The PAR polarity complex of PARD3, PARD6, and an atypical protein kinase C (aPKC) regulate several aspects of neuronal migration.[review]
24136590 Our results suggest that PAR-3 has a role in the clinical aggressiveness of cell Renal Cell Carcinoma
23322019 Data show that increased partitioning defective 3 (Par-3) expression is associated with distant metastasis and poor survival rates in patients with hepatocellular carcinoma (HCC).
23263278 Suggest that loss of Par3 promotes metastatic behaviour of ErbB2-induced breast tumour epithelial cells by decreasing cell-cell cohesion.
23153534 Par3 is identified as a regulator of signaling pathways relevant to invasive breast cancer.
22883624 The scaffolding adaptor GAB1 interacts with two polarity proteins, PAR1 and PAR3.
22447895 genetic association studies in a Chinese Han population: Data suggest that 6 SNPs in PARD3 (rs2496720, rs2252655, rs3851068, rs118153230, rs10827337, rs12218196) are associated with neural tube defects/anencephaly in this population.
22398721 A VE-cadherin-PAR3-alpha-catenin complex regulates the Golgi localization and activity of cytosolic phospholipase A(2)alpha in endothelial cells.(
21865402 Changes in cell polarity proteins Par-3 and PP-1 are associated with altered expression and assembly of tight junction proteins claudin-2, -3, -5 and -7 and ZO-1, causing paracellular leakage in active coeliac disease.
21549621 Data indicate that both tumor focality and Par3/Par6/atypical protein kinase C (APKC) expression were significantly associated with tumor recurrence.
21515326 there was no association of MAGI2 and PARD3 with IBD.
21170030 Data show that DDR1 coordinates the Par3/Par6 cell-polarity complex through its carboxy terminus, binding PDZ domains in Par3 and Par6.
20959641 Factors-derived from preeclapsia placentas not only interrupt junction protein VE-cadherin distribution, but also perturb polarity protein PARD-3 expression and distribution in vascular endothelium
20933426 Par3 controls epithelial spindle orientation by aPKC-mediated phosphorylation of apical Pins.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20191563 The results suggest that Par3 directly interacts with FAK and PI3-kinase, enhancing their activities for polarized cell migration.
20096742 Observational study of gene-disease association. (HuGE Navigator)
20095854 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19812038 Data show that Aurora A interacts directly with the atypical protein kinase C binding domain of Par3 and phosphorylates it at serine 962.
19737411 Pard-3 and AS3 genes are mutationally inactivated in prostate cancer cells.
19592499 Cell polarity factor Par3 binds SPTLC1 and modulates monocyte serine palmitoyltransferase activity and chemotaxis
19503097 Results suggest that deletion and reduced expression of PARD3 may be a novel mechanism that drives the progression of ESCC.
19240061 Observational study of gene-disease association. (HuGE Navigator)
18984674 Observational study of gene-disease association. (HuGE Navigator)
18685789 identified 10 potential novel binding proteins of PDZ domains of Par3 in Jurkat cells
18636124 Observational study of gene-disease association. (HuGE Navigator)
18562307 Neph1-Nephrin proteins bind the Par3-Par6-atypical protein kinase C (aPKC) complex to regulate podocyte cell polarity
18319301 Two polarity proteins, Par3 and Par6, are also required for EC lumen and tube formation, as they establish EC polarity through their association with Cdc42 and atypical PKC.
17989107 Observational study of gene-disease association. (HuGE Navigator)
17609107 Because Numb interacts with the aPKC binding partner PAR-3, we propose a model in which polarized Numb phosphorylation contributes to cell migration by directing integrin endocytosis to the leading edge
17287830 Par3 is a novel component of the DNA-PK complex that implicates an unexpected link of cell polarity to double-strand DNA break repair.
17057644 We provide evidence for the existence of a distinct PAR protein complex in endothelial cells. Both PAR-3 and PAR-6 associate directly with the adherens junction protein vascular endothelial cadherin (VE-cadherin).
17053785 fine-tuning mechanism of Par3 in epithelial tight junction assembly controlled by the EGF receptor-SFK signaling pathway.
16385451 Observational study of gene-disease association. (HuGE Navigator)
15782111 findings demonstrated that G-protein-activated phospholipase C-beta interacts with cell polarity proteins Par3 and Par6 to form protein complexes and to mediate downstream signal transduction

AA Sequence

MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVAD      1 - 70
DKDRLVAVFDEQDPHHGGDGTSASSTGTQSPEIFGSELGTNNVSAFQPYQATSEIEVTPSVLRANMPLHV     71 - 140
RRSSDPALIGLSTSVSDSNFSSEEPSRKNPTRWSTTAGFLKQNTAGSPKTCDRKKDENYRSLPRDTSNWS    141 - 210
NQFQRDNARSSLSASHPMVGKWLEKQEQDEDGTEEDNSRVEPVGHADTGLEHIPNFSLDDMVKLVEVPND    211 - 280
GGPLGIHVVPFSARGGRTLGLLVKRLEKGGKAEHENLFRENDCIVRINDGDLRNRRFEQAQHMFRQAMRT    281 - 350
PIIWFHVVPAANKEQYEQLSQSEKNNYYSSRFSPDSQYIDNRSVNSAGLHTVQRAPRLNHPPEQIDSHSR    351 - 420
LPHSAHPSGKPPSAPASAPQNVFSTTVSSGYNTKKIGKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYV    421 - 490
KNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVVSLLRSTKMEGTVSLLVFRQEDAFHPRELNAEP    491 - 560
SQMQIPKETKAEDEDIVLTPDGTREFLTFEVPLNDSGSAGLGVSVKGNRSKENHADLGIFVKSIINGGAA    561 - 630
SKDGRLRVNDQLIAVNGESLLGKTNQDAMETLRRSMSTEGNKRGMIQLIVARRISKCNELKSPGSPPGPE    631 - 700
LPIETALDDRERRISHSLYSGIEGLDESPSRNAALSRIMGESGKYQLSPTVNMPQDDTVIIEDDRLPVLP    701 - 770
PHLSDQSSSSSHDDVGFVTADAGTWAKAAISDSADCSLSPDVDPVLAFQREGFGRQSMSEKRTKQFSDAS    771 - 840
QLDFVKTRKSKSMDLGIADETKLNTVDDQKAGSPSRDVGPSLGLKKSSSLESLQTAVAEVTLNGDIPFHR    841 - 910
PRPRIIRGRGCNESFRAAIDKSYDKPAVDDDDEGMETLEEDTEESSRSGRESVSTASDQPSHSLERQMNG    911 - 980
NQEKGDKTDRKKDKTGKEKKKDRDKEKDKMKAKKGMLKGLGDMFRFGKHRKDDKIEKTGKIKIQESFTSE    981 - 1050
EERIRMKQEQERIQAKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREG   1051 - 1120
HMMDALYAQVKKPRNSKPSPVDSNRSTPSNHDRIQRLRQEFQQAKQDEDVEDRRRTYSFEQPWPNARPAT   1121 - 1190
QSGRHSVSVEVQMQRQRQEERESSQQAQRQYSSLPRQSRKNASSVSQDSWEQNYSPGEGFQSAKENPRYS   1191 - 1260
SYQGSRNGYLGGHGFNARVMLETQELLRQEQRRKEQQMKKQPPSEGPSNYDSYKKVQDPSYAPPKGPFRQ   1261 - 1330
DVPPSPSQVARLNRLQTPEKGRPFYS                                               1331 - 1356
//

Text Mined References (98)

PMID Year Title
26589794 2016 Cancer Cell Invasion in Three-dimensional Collagen Is Regulated Differentially by G?13 Protein and Discoidin Domain Receptor 1-Par3 Protein Signaling.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26116754 2015 PARD3 induces TAZ activation and cell growth by promoting LATS1 and PP1 interaction.
26050620 2016 Shp2 promotes metastasis of prostate cancer by attenuating the PAR3/PAR6/aPKC polarity protein complex and enhancing epithelial-to-mesenchymal transition.
25833829 2015 PARD3 Inactivation in Lung Squamous Cell Carcinomas Impairs STAT3 and Promotes Malignant Invasion.
25820151 2015 Par-3 modulates intestinal epithelial barrier function through regulating intracellular trafficking of occludin and myosin light chain phosphorylation.
25518939 2015 PAR3 and aPKC regulate Golgi organization through CLASP2 phosphorylation to generate cell polarity.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24856572 2014 Cytoplasmic PAR-3 protein expression is associated with adverse prognostic factors in clear cell renal cell carcinoma and independently impacts survival.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
24243103 2014 The PAR polarity complex and cerebellar granule neuron migration.
24136590 2014 Overexpression of the polarity protein PAR-3 in clear cell renal cell carcinoma is associated with poor prognosis.
23832200 2013 High-resolution structure of the Tiam1 PHn-CC-Ex domain.
23322019 2013 Expression of partitioning defective 3 (Par-3) for predicting extrahepatic metastasis and survival with hepatocellular carcinoma.
23263278 2013 Loss of Par3 promotes breast cancer metastasis by compromising cell-cell cohesion.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23153534 2012 Loss of the Par3 polarity protein promotes breast tumorigenesis and metastasis.
22883624 2012 The signaling adaptor GAB1 regulates cell polarity by acting as a PAR protein scaffold.
22653443 2012 Mutant p53 interactome identifies nardilysin as a p53R273H-specific binding partner that promotes invasion.
22447895 2012 Association study of PARD3 gene polymorphisms with neural tube defects in a Chinese Han population.
22398721 2012 A VE-cadherin-PAR3-?-catenin complex regulates the Golgi localization and activity of cytosolic phospholipase A(2)? in endothelial cells.
22006950 2011 Lulu2 regulates the circumferential actomyosin tensile system in epithelial cells through p114RhoGEF.
21949390 2011 Sir-two-homolog 2 (Sirt2) modulates peripheral myelination through polarity protein Par-3/atypical protein kinase C (aPKC) signaling.
21865402 2012 Cell polarity-determining proteins Par-3 and PP-1 are involved in epithelial tight junction defects in coeliac disease.
21682944 2012 DOCK4 and CEACAM21 as novel schizophrenia candidate genes in the Jewish population.
21621269 2011 Genome-wide association analysis of gender differences in major depressive disorder in the Netherlands NESDA and NTR population-based samples.
21549621 2013 Loss of APKC expression independently predicts tumor recurrence in superficial bladder cancers.
21515326 2011 Replication of genetic variation in the MYO9B gene in Crohn's disease.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21170030 2011 Collective cell migration requires suppression of actomyosin at cell-cell contacts mediated by DDR1 and the cell polarity regulators Par3 and Par6.
20959641 2011 Factors derived from preeclamptic placentas perturb polarity protein PARD-3 expression and distribution in endothelial cells.
20933426 2010 Par3 controls epithelial spindle orientation by aPKC-mediated phosphorylation of apical Pins.
20709820 2011 Genome-wide association study identifies BICD1 as a susceptibility gene for emphysema.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20332120 2010 CCM1 regulates vascular-lumen organization by inducing endothelial polarity.
20191563 2010 Identification of focal adhesion kinase (FAK) and phosphatidylinositol 3-kinase (PI3-kinase) as Par3 partners by proteomic analysis.
20096742 2010 Intestinal barrier gene variants may not explain the increased levels of antigliadin antibodies, suggesting other mechanisms than altered permeability.
20095854 2010 Novel breast cancer risk alleles and interaction with ionizing radiation among U.S. radiologic technologists.
20073081 2010 Rapid, robotic, small-scale protein production for NMR screening and structure determination.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19893486 2010 The PHCCEx domain of Tiam1/2 is a novel protein- and membrane-binding module.
19812038 2009 Phosphorylation of the par polarity complex protein Par3 at serine 962 is mediated by aurora a and regulates its function in neuronal polarity.
19737411 2009 Par-3 partitioning defective 3 homolog (C. elegans) and androgen-induced prostate proliferative shutoff associated protein genes are mutationally inactivated in prostate cancer cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19684603 2009 Germline genomic variants associated with childhood acute lymphoblastic leukemia.
19592499 2009 Cell polarity factor Par3 binds SPTLC1 and modulates monocyte serine palmitoyltransferase activity and chemotaxis.
19503097 2009 Defective expression of polarity protein PAR-3 gene (PARD3) in esophageal squamous cell carcinoma.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18984674 2009 KIF5B gene sequence variation and response of cardiac stroke volume to regular exercise.
18838552 2008 The keratin-binding protein Albatross regulates polarization of epithelial cells.
18685789 2008 Proteome identification of binding-partners interacting with cell polarity protein Par3 in Jurkat cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18562307 2008 Neph-Nephrin proteins bind the Par3-Par6-atypical protein kinase C (aPKC) complex to regulate podocyte cell polarity.
18319301 2008 Cdc42- and Rac1-mediated endothelial lumen formation requires Pak2, Pak4 and Par3, and PKC-dependent signaling.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17989107 2008 Associations with tight junction genes PARD3 and MAGI2 in Dutch patients point to a common barrier defect for coeliac disease and ulcerative colitis.
17979178 2007 A novel tandem affinity purification strategy for the efficient isolation and characterisation of native protein complexes.
17609107 2007 Numb controls integrin endocytosis for directional cell migration with aPKC and PAR-3.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17287830 2007 Cell polarity protein Par3 complexes with DNA-PK via Ku70 and regulates DNA double-strand break repair.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17057644 2006 A distinct PAR complex associates physically with VE-cadherin in vertebrate endothelial cells.
17053785 2006 Tyrosine phosphorylated Par3 regulates epithelial tight junction assembly promoted by EGFR signaling.
16678097 2006 A Rich1/Amot complex regulates the Cdc42 GTPase and apical-polarity proteins in epithelial cells.
16505165 2006 Par-3 mediates the inhibition of LIM kinase 2 to regulate cofilin phosphorylation and tight junction assembly.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16341674 2005 Transcriptome analysis of human gastric cancer.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15782111 2005 G-protein-activated phospholipase C-beta, new partners for cell polarity proteins Par3 and Par6.
15723052 2005 Par-3 controls tight junction assembly through the Rac exchange factor Tiam1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15254234 2004 Nucleotide exchange factor ECT2 interacts with the polarity protein complex Par6/Par3/protein kinase Czeta (PKCzeta) and regulates PKCzeta activity.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15161933 2004 Comprehensive proteomic analysis of interphase and mitotic 14-3-3-binding proteins.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14760703 2004 Proteomic identification of brain proteins that interact with dynein light chain LC8.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676191 2004 Comprehensive proteomic analysis of human Par protein complexes reveals an interconnected protein network.
12650946 2003 Identification of three novel Smad binding proteins involved in cell polarity.
12515806 2003 Direct binding of cell polarity protein PAR-3 to cell-cell adhesion molecule nectin at neuroepithelial cells of developing mouse.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12459187 2002 PAR3beta, a novel homologue of the cell polarity protein PAR3, localizes to tight junctions.
12234671 2002 Multiple splice variants of Par3 and of a novel related gene, Par3L, produce proteins with different binding properties.
11642408 2001 Down-regulated expression of atypical PKC-binding domain deleted asip isoforms in human hepatocellular carcinomas.
11447115 2001 The cell polarity protein ASIP/PAR-3 directly associates with junctional adhesion molecule (JAM).
11260256 2001 Human homologues of the Caenorhabditis elegans cell polarity protein PAR6 as an adaptor that links the small GTPases Rac and Cdc42 to atypical protein kinase C.
11257119 2001 Atypical protein kinase C is involved in the evolutionarily conserved par protein complex and plays a critical role in establishing epithelia-specific junctional structures.
11149944 2001 Serological detection of cutaneous T-cell lymphoma-associated antigens.
10954424 2000 The mammalian homologue of the Caenorhabditis elegans polarity protein PAR-6 is a binding partner for the Rho GTPases Cdc42 and Rac1.
10934474 2000 The cell-polarity protein Par6 links Par3 and atypical protein kinase C to Cdc42.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.