Property Summary

NCBI Gene PubMed Count 11
PubMed Score 76.37
PubTator Score 28.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 3.8e-10
ovarian cancer 8491 3.3e-07
interstitial cystitis 2299 8.9e-05
Disease Target Count Z-score Confidence
Acute cystitis 37 3.534 1.8
Leishmaniasis 49 3.458 1.7
Sleeping sickness 37 3.167 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -3.425 3.8e-10
interstitial cystitis -1.300 8.9e-05
ovarian cancer -1.400 3.3e-07

Gene RIF (4)

PMID Text
21761364 Data show abundant mPRalpha (PAQR7), mPRbeta (PAQR8), and mPRgamma (PAQR5), but not classical nuclear PR (A or B isoforms) mRNA expression and mPRalpha protein expression in a panel of commonly used ovarian cancer cell lines.
19071147 mPRalpha is an intermediary in progestin stimulation of sperm motility in humans by a mechanism involving G-protein activation
18603275 Heterologous expression of MPRA in yeast confirms its ability to function as a membrane progesterone receptor.
17082257 cDNAs for the mPR alpha subtypes from spotted seatrout (st-mPRalpha) and humans (hu-mPRalpha) encode progestin receptors that display many functional characteristics of G protein-coupled receptors.

AA Sequence

MAMAQKLSHLLPSLRQVIQEPQLSLQPEPVFTVDRAEVPPLFWKPYIYAGYRPLHQTWRFYFRTLFQQHN      1 - 70
EAVNVWTHLLAALVLLLRLALFVETVDFWGDPHALPLFIIVLASFTYLSFSALAHLLQAKSEFWHYSFFF     71 - 140
LDYVGVAVYQFGSALAHFYYAIEPAWHAQVQAVFLPMAAFLAWLSCIGSCYNKYIQKPGLLGRTCQEVPS    141 - 210
VLAYALDISPVVHRIFVSSDPTTDDPALLYHKCQVVFFLLAAAFFSTFMPERWFPGSCHVFGQGHQLFHI    211 - 280
FLVLCTLAQLEAVALDYEARRPIYEPLHTHWPHNFSGLFLLTVGSSILTAFLLSQLVQRKLDQKTK        281 - 346
//

Text Mined References (12)

PMID Year Title
21761364 2010 Expression of membrane progesterone receptors (mPR/PAQR) in ovarian cancer cells: implications for progesterone-induced signaling events.
19071147 2009 Progestin functions in vertebrate gametes mediated by membrane progestin receptors (mPRs): Identification of mPRalpha on human sperm and its association with sperm motility.
18603275 2008 Heterologous expression of human mPRalpha, mPRbeta and mPRgamma in yeast confirms their ability to function as membrane progesterone receptors.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17082257 2007 Steroid and G protein binding characteristics of the seatrout and human progestin membrane receptor alpha subtypes and their evolutionary origins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16044242 2005 PAQR proteins: a novel membrane receptor family defined by an ancient 7-transmembrane pass motif.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12606724 2003 The further redefining of steroid-mediated signaling.
12601167 2003 Identification, classification, and partial characterization of genes in humans and other vertebrates homologous to a fish membrane progestin receptor.
12574519 2003 Cloning, expression, and characterization of a membrane progestin receptor and evidence it is an intermediary in meiotic maturation of fish oocytes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.