Property Summary

NCBI Gene PubMed Count 22
PubMed Score 19.40
PubTator Score 14.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung cancer 4473 1.5e-04
active Crohn's disease 918 3.6e-02

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 2.000 1.5e-04
active Crohn's disease 1.238 3.6e-02

 GO Function (1)

Gene RIF (16)

PMID Text
26905590 findings not only pinpoint that Twist1 mediates the modulatory function of PAQR3 on EMT and metastasis but also suggest that targeting Twist1 is a promising strategy to control metastasis of tumors with downregulation of PAQR3
26327583 A novel role for the newly characterized, Golgi-localized PAQR3 in regulating heterotrimeric G-proteins at the non-canonical subcellular location of the Golgi.
26311497 PAQR3 regulates cholesterol homeostasis by anchoring Scap/SREBP to the Golgi and disruption of such function reduces cholesterol biosynthesis.
26205499 DDB2 is involved in ubiquitination and degradation of PAQR3 in gastric cancer cells.
25900239 Our data indicate that PAQR3 functions as a tumor suppressor in the development of human breast cancers.
25706881 PAQR3 (progestin and adipoQ receptors member 3), a tumour suppressor specifically localized in the Golgi apparatus, negatively regulates H3K4 trimethylation (H3K4me3).
25510670 PAQR3 might act as a tumor suppressor in osteosarcoma.
25330156 MicroRNA-137 upregulation increases bladder cancer cell proliferation and invasion by targeting PAQR3
25310770 PAQR3 may play an important role in the progression of hepatocellular carcinoma and serve as a potential candidate for the targeted therapy of hepatocellular carcinoma
24799462 PAQR3 is markedly down-regulated in human gastric cancers. PAQR3 expression level is closely associated with the progression and metastasis of gastric cancers
22828136 Loss of PAQR3 is associated with tumorigenesis of colorectal cancers.
19884349 RKTG can modulate GPCR signaling through sequestering G betagamma to the Golgi apparatus and thereby attenuating the functions of G betagamma.
19519172 Data show that adiponectin functions as an agonist of PAQR3.
18547165 Analysis in detail of the topology and functional domains of RKTG (Raf kinase trapping to Golgi).
18515281 RKTG may play a suppressive role in human melanoma that harbors an oncogenic B-Raf mutation via its antagonistic action on B-Raf.
17724343 reveal a paradigm of spatial regulation of Raf kinase by RKTG via sequestrating Raf-1 to the Golgi apparatus and thereby inhibiting the ERK signaling pathway.

AA Sequence

MHQKLLKSAHYIELGSYQYWPVLVPRGIRLYTYEQIPGSLKDNPYITDGYRAYLPSRLCIKSLFILSNET      1 - 70
VNIWSHLLGFFLFFTLGIYDMTSVLPSASASREDFVICSICLFCFQVCMLCSVGYHLFSCHRSEKTCRRW     71 - 140
MALDYAGISIGILGCYVSGVFYAFYCNNYWRQVYLITVLAMILAVFFAQIHPNYLTQQWQRLRSIIFCSV    141 - 210
SGYGVIPTLHWVWLNGGIGAPIVQDFAPRVIVMYMIALLAFLFYISKVPERYFPGQLNYLGSSHQIWHIL    211 - 280
AVVMLYWWHQSTVYVMQYRHSKPCPDYVSHL                                           281 - 311
//

Text Mined References (22)

PMID Year Title
26905590 2016 PAQR3 enhances Twist1 degradation to suppress epithelial-mesenchymal transition and metastasis of gastric cancer cells.
26327583 2015 PAQR3 regulates Golgi vesicle fission and transport via the G??-PKD signaling pathway.
26311497 2015 PAQR3 modulates cholesterol homeostasis by anchoring Scap/SREBP complex to the Golgi apparatus.
26205499 2015 DDB2 is involved in ubiquitination and degradation of PAQR3 and regulates tumorigenesis of gastric cancer cells.
25900239 2015 PAQR3 expression is downregulated in human breast cancers and correlated with HER2 expression.
25706881 2015 PAQR3 modulates H3K4 trimethylation by spatial modulation of the regulatory subunits of COMPASS-like complexes in mammalian cells.
25510670 2015 The tumor suppressor role of PAQR3 in osteosarcoma.
25330156 2014 MicroRNA-137 upregulation increases bladder cancer cell proliferation and invasion by targeting PAQR3.
25310770 2014 Identification of PAQR3 as a new candidate tumor suppressor in hepatocellular carcinoma.
24799462 2014 A Golgi-specific protein PAQR3 is closely associated with the progression, metastasis and prognosis of human gastric cancers.
22828136 2012 PAQR3 plays a suppressive role in the tumorigenesis of colorectal cancers.
19884349 2010 Regulation of G-protein signaling by RKTG via sequestration of the G betagamma subunit to the Golgi apparatus.
19519172 2009 Adiponectin identified as an agonist for PAQR3/RKTG using a yeast-based assay system.
18547165 2008 Characterization of the topology and functional domains of RKTG.
18515281 2008 RKTG sequesters B-Raf to the Golgi apparatus and inhibits the proliferation and tumorigenicity of human malignant melanoma cells.
17724343 2007 Spatial regulation of Raf kinase signaling by RKTG.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16044242 2005 PAQR proteins: a novel membrane receptor family defined by an ancient 7-transmembrane pass motif.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.