Property Summary

NCBI Gene PubMed Count 22
PubMed Score 41.76
PubTator Score 25.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma -5.300 5.8e-09
astrocytic glioma 1.100 4.8e-02
Barrett's esophagus 1.400 2.6e-02
osteosarcoma 2.760 7.2e-04
medulloblastoma, large-cell -2.000 1.1e-04
adrenocortical carcinoma -1.410 4.2e-02
tuberculosis and treatment for 6 months -2.300 7.4e-05
pancreatic ductal adenocarcinoma liver m... -1.612 1.9e-02
non-small cell lung cancer -1.926 3.9e-19
intraductal papillary-mucinous neoplasm ... -1.200 1.7e-03
lung cancer -3.400 3.2e-05
colon cancer -2.000 1.4e-03
interstitial cystitis 1.300 3.3e-05
lung adenocarcinoma -1.700 9.7e-09
pilocytic astrocytoma 1.400 1.7e-06
primary Sjogren syndrome 1.500 3.7e-03
aldosterone-producing adenoma -1.280 4.0e-02
nasopharyngeal carcinoma 1.600 4.3e-03
lung carcinoma -2.600 6.1e-18
Pick disease 1.600 1.4e-02
gastric carcinoma 1.200 2.6e-02
ulcerative colitis -1.100 2.3e-04
ovarian cancer -4.600 3.0e-14
pituitary cancer -1.900 2.1e-04

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (12)

PMID Text
25679447 Results suggest that the loss of the susceptible region on chromosome 10q, which implicates PTEN, FAS and PAPSS2 may serve as genetic predictors of PSA recurrence after radical prostatectomy.
25594860 Direct in vivo evidence for the significant functional impact of mutant PAPSS2 on DHEA sulfation and androgen activation.
23824674 PAPSS2-brachyolmia includes phenotypes of the conventional clinical concept of brachyolmia, the Hobaek and Toledo types, and is associated with abnormal androgen metabolism.
22791835 PAPSS2 is the disease gene for an autosomal recessive brachyolmia.
22394585 Papss2 expression is reduced in articular cartilage following transforming growth factor-beta administration.
22242175 Unusual localisation signals of both PAPS synthase isoforms, are described.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19727025 Thirty-seven novel SNPs in the PAPSS2 gene and in two intergenic regions on chromosomes 2q33.1 and 18p11.32 were associated with exercise participation.
19727025 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)
11931653 Transcriptional regulation of human 3'-phosphoadenosine 5'-phosphosulphate synthase 2.
11558903 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSGIKKQKTENQQKSTNVVYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTISFALEEYLVSHA      1 - 70
IPCYSLDGDNVRHGLNRNLGFSPGDREENIRRIAEVAKLFADAGLVCITSFISPFAKDRENARKIHESAG     71 - 140
LPFFEIFVDAPLNICESRDVKGLYKRARAGEIKGFTGIDSDYEKPETPERVLKTNLSTVSDCVHQVVELL    141 - 210
QEQNIVPYTIIKDIHELFVPENKLDHVRAEAETLPSLSITKLDLQWVQVLSEGWATPLKGFMREKEYLQV    211 - 280
MHFDTLLDDGVINMSIPIVLPVSAEDKTRLEGCSKFVLAHGGRRVAILRDAEFYEHRKEERCSRVWGTTC    281 - 350
TKHPHIKMVMESGDWLVGGDLQVLEKIRWNDGLDQYRLTPLELKQKCKEMNADAVFAFQLRNPVHNGHAL    351 - 420
LMQDTRRRLLERGYKHPVLLLHPLGGWTKDDDVPLDWRMKQHAAVLEEGVLDPKSTIVAIFPSPMLYAGP    421 - 490
TEVQWHCRSRMIAGANFYIVGRDPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPFRVAAYNKAKK    491 - 560
AMDFYDPARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN                    561 - 614
//

Text Mined References (26)

PMID Year Title
25679447 2015 Exploring prostate cancer genome reveals simultaneous losses of PTEN, FAS and PAPSS2 in patients with PSA recurrence after radical prostatectomy.
25594860 2015 PAPSS2 deficiency causes androgen excess via impaired DHEA sulfation--in vitro and in vivo studies in a family harboring two novel PAPSS2 mutations.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23824674 2013 Clinical and radiographic features of the autosomal recessive form of brachyolmia caused by PAPSS2 mutations.
23633440 2013 Spondyloepimetaphyseal dysplasia Pakistani type: expansion of the phenotype.
22791835 2012 PAPSS2 mutations cause autosomal recessive brachyolmia.
22394585 2012 Altered responsiveness to TGF-? results in reduced Papss2 expression and alterations in the biomechanical properties of mouse articular cartilage.
22242175 2012 Human PAPS synthase isoforms are dynamically regulated enzymes with access to nucleus and cytoplasm.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19727025 2009 Genome-wide association study of exercise behavior in Dutch and American adults.
19474428 2009 Inactivating PAPSS2 mutations in a patient with premature pubarche.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11931637 2002 Characterization and expression of human bifunctional 3'-phosphoadenosine 5'-phosphosulphate synthase isoforms.
11773860 2002 Human 3'-phosphoadenosine 5'-phosphosulfate synthetase 2 (PAPSS2) pharmacogenetics: gene resequencing, genetic polymorphisms and functional characterization of variant allozymes.
11558903 2001 Identification of sequence polymorphisms in two sulfation-related genes, PAPSS2 and SLC26A2, and an association analysis with knee osteoarthritis.
11159808 2001 Human 3'-phosphoadenosine 5'-phosphosulfate synthetase: radiochemical enzymatic assay, biochemical properties, and hepatic variation.
10679223 2000 Human 3'-phosphoadenosine 5'-phosphosulfate synthetase 1 (PAPSS1) and PAPSS2: gene cloning, characterization and chromosomal localization.
10657990 2000 Nuclear localization of PAPS synthetase 1: a sulfate activation pathway in the nucleus of eukaryotic cells.
10559207 1999 Genomic organization of the mouse and human genes encoding the ATP sulfurylase/adenosine 5'-phosphosulfate kinase isoform SK2.
9771708 1998 Mutations in orthologous genes in human spondyloepimetaphyseal dysplasia and the brachymorphic mouse.
9714015 1998 Distinct, autosomal recessive form of spondyloepimetaphyseal dysplasia segregating in an inbred Pakistani kindred.
9671738 1998 A member of a family of sulfate-activating enzymes causes murine brachymorphism.