Property Summary

NCBI Gene PubMed Count 28
PubMed Score 270.44
PubTator Score 18.22

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.104 1.9e-02
Multiple myeloma 1.177 2.1e-02
malignant mesothelioma -1.700 1.9e-07
psoriasis 1.300 2.2e-04
osteosarcoma 1.731 1.7e-05
medulloblastoma, large-cell 1.100 2.9e-02
lung cancer 1.500 5.9e-05
Breast cancer 2.300 2.8e-02
ovarian cancer 2.600 1.2e-05

Gene RIF (16)

PMID Text
25948711 These data indicate that knocking down PAPSS increases UGT2B4 transcription and mRNA stability as a compensatory response to the loss of SULT2A1 activity
25482303 leptin signalling links a novel SFK/ERK1/2-mediated pathway and SK1 expression.
24587339 SK1 positivity and high expression were significantly associated with cancer and a shorter 5-year and overall survival.
22380844 study showed expression patterns of SULT1E1 and PAPSS in breast and endometrial tissues; the estrogen sulfation enzymes were comparatively higher in the tumorous tissues than adjacent normal tissues; overexpression of SULT1E1 and PAPSS1 retarded MCF-7 cells growth in vivo and in vitro by arresting cell cycles and inducing apoptosis
22242175 Unusual localisation signals of both PAPS synthase isoforms, are described.
20335228 SK1 plays an essential role in regulating in vitro paracrine angiogenesis and lymphangiogenesis.
20332099 Observational study of gene-disease association. (HuGE Navigator)
19337310 PAPSS1 maps to chromosome 4q25 and may havea role in hepatocellular carcinoma
19337310 Observational study of gene-disease association. (HuGE Navigator)
19008949 a role for PAPSS1 in the cellular sulfonation pathway requirement at a stage during or shortly after MLV provirus establishment, and subsequent influence on gene expression from the viral long terminal repeat promoter
17540769 ATP-sulfurylase domain of PAPS synthetase influences these elements in adenylylsulfate kinase, which may be a mechanism between both domains the this bifunctional enzyme
15755455 Results describe the crystal structure of human PAPSS1 at 1.8 angstroms resolution.
15065880 The kinetic characteristics of the individual sulfurylase and kinase activities of PAPSS isoform 1, the predominant form in human brain, are described.
14747722 x-ray crystallographic analysis of 3'-phosphoadenosine-5'-phosphosulfate synthetase 1
12716056 review of PAPSS biochemistry, molecular biology and genetics
11931637 characterization and expression of bifunctional isoforms

AA Sequence

MEIPGSLCKKVKLSNNAQNWGMQRATNVTYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTVSM      1 - 70
ALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRN     71 - 140
NARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTDSCDVN    141 - 210
DCVQQVVELLQERDIVPVDASYEVKELYVPENKLHLAKTDAETLPALKINKVDMQWVQVLAEGWATPLNG    211 - 280
FMREREYLQCLHFDCLLDGGVINLSVPIVLTATHEDKERLDGCTAFALMYEGRRVAILRNPEFFEHRKEE    281 - 350
RCARQWGTTCKNHPYIKMVMEQGDWLIGGDLQVLDRVYWNDGLDQYRLTPTELKQKFKDMNADAVFAFQL    351 - 420
RNPVHNGHALLMQDTHKQLLERGYRRPVLLLHPLGGWTKDDDVPLMWRMKQHAAVLEEGVLNPETTVVAI    421 - 490
FPSPMMYAGPTEVQWHCRARMVAGANFYIVGRDPAGMPHPETGKDLYEPSHGAKVLTMAPGLITLEIVPF    491 - 560
RVAAYNKKKKRMDYYDSEHHEDFEFISGTRMRKLAREGQKPPEGFMAPKAWTVLTEYYKSLEKA          561 - 624
//

Text Mined References (30)

PMID Year Title
25948711 2015 Upregulation of UGT2B4 Expression by 3'-Phosphoadenosine-5'-Phosphosulfate Synthase Knockdown: Implications for Coordinated Control of Bile Acid Conjugation.
25482303 2014 Leptin induces upregulation of sphingosine kinase 1 in oestrogen receptor-negative breast cancer via Src family kinase-mediated, janus kinase 2-independent pathway.
24587339 2014 Sphingosine kinase 1 and cancer: a systematic review and meta-analysis.
24478790 2013 Genome wide association and linkage analyses identified three loci-4q25, 17q23.2, and 10q11.21-associated with variation in leukocyte telomere length: the Long Life Family Study.
22380844 2012 Effect of estrogen sulfation by SULT1E1 and PAPSS on the development of estrogen-dependent cancers.
22242175 2012 Human PAPS synthase isoforms are dynamically regulated enzymes with access to nucleus and cytoplasm.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20335228 2010 Role of sphingosine kinase-1 in paracrine/transcellular angiogenesis and lymphangiogenesis in vitro.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
19337310 2009 Evidence for association with hepatocellular carcinoma at the PAPSS1 locus on chromosome 4q25 in a family-based study.
19008949 2008 The host cell sulfonation pathway contributes to retroviral infection at a step coincident with provirus establishment.
17540769 2007 Structural mechanism for substrate inhibition of the adenosine 5'-phosphosulfate kinase domain of human 3'-phosphoadenosine 5'-phosphosulfate synthetase 1 and its ramifications for enzyme regulation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15755455 2005 The crystal structure of human PAPS synthetase 1 reveals asymmetry in substrate binding.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15065880 2004 Human 3'-phosphoadenosine 5'-phosphosulfate synthetase (isoform 1, brain): kinetic properties of the adenosine triphosphate sulfurylase and adenosine 5'-phosphosulfate kinase domains.
14747722 2004 Expression, purification and crystallization of human 3'-phosphoadenosine-5'-phosphosulfate synthetase 1.
12716056 2003 Human 3'-phosphoadenosine 5'-phosphosulfate (PAPS) synthase: biochemistry, molecular biology and genetic deficiency.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11931637 2002 Characterization and expression of human bifunctional 3'-phosphoadenosine 5'-phosphosulphate synthase isoforms.
10679223 2000 Human 3'-phosphoadenosine 5'-phosphosulfate synthetase 1 (PAPSS1) and PAPSS2: gene cloning, characterization and chromosomal localization.
10657990 2000 Nuclear localization of PAPS synthetase 1: a sulfate activation pathway in the nucleus of eukaryotic cells.
9915785 1999 Site-selected mutagenesis of a conserved nucleotide binding HXGH motif located in the ATP sulfurylase domain of human bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase.
9771708 1998 Mutations in orthologous genes in human spondyloepimetaphyseal dysplasia and the brachymorphic mouse.
9671738 1998 A member of a family of sulfate-activating enzymes causes murine brachymorphism.
9668121 1998 Molecular cloning, expression, and characterization of human bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase and its functional domains.
9648242 1998 cDNA cloning, expression, and characterization of the human bifunctional ATP sulfurylase/adenosine 5'-phosphosulfate kinase enzyme.
9576487 1998 Sulfation in high endothelial venules: cloning and expression of the human PAPS synthetase.