Property Summary

NCBI Gene PubMed Count 198
PubMed Score 1275.19
PubTator Score 1178.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -3.000 8.9e-08
osteosarcoma -3.184 4.6e-07
atypical teratoid / rhabdoid tumor 2.000 7.8e-03
glioblastoma 1.700 2.1e-02
medulloblastoma, large-cell 1.500 3.4e-03
primitive neuroectodermal tumor 2.800 2.1e-03
adrenocortical carcinoma -1.606 2.1e-02
intraductal papillary-mucinous carcinoma... -3.000 1.3e-02
intraductal papillary-mucinous neoplasm ... -2.900 4.6e-02
cystic fibrosis 1.600 1.0e-02
adult high grade glioma -1.200 1.0e-02
group 3 medulloblastoma 1.400 4.0e-02
pilocytic astrocytoma 1.200 3.4e-02
non primary Sjogren syndrome sicca -1.300 1.6e-02
nasopharyngeal carcinoma 1.100 4.0e-02
ulcerative colitis 2.100 1.1e-03
ovarian cancer -3.300 1.0e-08
head and neck cancer 1.700 5.7e-06

Protein-protein Interaction (2)

Gene RIF (164)

PMID Text
27125092 PAPP-A determination during the first trimester of pregnancy in women at risk for IUGR makes possible the prophylactic treatment and monitoring of pregnancy.
26823756 miR-141 may play important roles in ox-LDL-induced abnormal proliferation of the vascular smooth muscle cells by targeting PAPPA.
26697810 The first trimester maternal PAPP-A levels were decreased in the ICSI group compared with those in the controls, but not in IVF and embryo transfer groups.
26362726 The performance of screening for GDM by maternal factors was not improved by the addition of PAPP-A and/or PLGF. First trimester maternal serum PAPP-A and PLGF are not useful in screening for GDM.
26336825 PAPP-A in ascites and tissue-associated PAPP-A serve to increase IGF bioactivity and, thereby, to stimulate IGF-IR-mediated ovarian tumor growth.
26297643 Suggest that PAPP-A is specifically involved in the regulation of steroidogenesis in human antral follicles.
26223809 Data indicate that rising pregnancy-associated plasma protein-A (PAPP-A) levels are prognostic in patients with coronary artery disease (CAD).
26214492 The study findings showed that plasma sCD40L, fetuin-A, and PAPP-A levels are associated with carotid plaque formation and instability.
26122709 The A>C variation of rs7020782 of PAPPA might be an independent risk factor for carotid plaque development and calcification.
26020769 PAPPA has a role in progression of liver cancer and is a novel paracrine inducer of the pro-tumorigenic NFkappaB signaling pathway
25858516 PAPP-A serum concentrations differed significantly between Asian and European women during the first trimester of pregnancy.
25846403 For Down syndrome affected pregnancies, the median MoM of first trimester PAPP-A, PlGF, and AFP were significantly reduced, and free-beta-hCG were significantly elevated.
25720282 The disease progression after treatment and achieved stabilization were found in patients with decreased activity of intracellular proteases and a high content of PAPP-A in the primary tumors.
25639820 Median PAPP-A MoM was 1.01 in the control group and 1.05 (P = 0.83) in praevia, compared with 1.22 in abnormally invasive placentation cases (0.16).
25633269 First-trimester maternal serum RBP4 was significantly increased and PAPP-A decreased in pregnancies that ended in early-onset preeclampsia compared to normal pregnancies.
25596909 Data suggest both serum PAPP-A and serum CRP (high-sensitivity C-reactive protein) are up-regulated during first trimester in women who will undergo early pregnancy failure.
25543334 Data indicate that the secretion of pregnancy-associated plasma protein-A (PAPP-A) was significantly very low in the context of any aneuploidy, with no increase during the culture.
25468445 High PAPP-A expression is associated with breast cancer.
25395363 PAPPA was similar between pregnant women with chronic kidney disease and controls.
25316741 A review concludes that evidence for the association of low PAPP-A levels with adverse perinatal outcomes is both lacking and mixed.
25238218 SE-selectin and PAPPA may contribute to future cardiovascular events in women post preeclampsia; in contrast, ApoB may be involved in a protective mechanism
25159705 Combined analysis of PAPP-A and free beta-hCG appears to be a potential candidate to predict early fetal loss.
25139218 first trimester PAPP-A levels were measured to see if they were associated with negative pregnancy outcome. Groups with high and low PAPP-A significantly differed only in miscarriages.
25108075 PAPP-A is associated with sudden death, stroke and infectious complications in diabetic dialysis patients.
25016703 Studied serum levels of GDF-15, IMA and PAPP-A in 348 patients with CAD and 205 controls. PAPP-A had the lowest sensitivity and negative predictive value compared with other markers. GDF-15 seemed to be associated with severity of CAD.
24940710 serum variations during the first trimester cannot be used as a marker of excessive fetal growth
24931331 Pregnancy-associated plasma protein A regulates mitosis and is epigenetically silenced in breast cancer.
24817938 PAPPA is up-regulated by progesterone, which promotes the adhesion and proliferation potential of trophoblastic cells.
24786703 inadequate sensitivity as first trimester serum marker for pre-eclampsia
24743523 A PAPP-A value, expressed in MoM, of 1.25 is a predictive factor of fetal birth weight >4000 g
24667032 study shows the significance of Cys327Cys PAPP-A SNP (rs12375498) for overall mortality of long term hemodialysis patients; although it does not influence the concentration of PAPP-A it still could affect the correct function of this enzyme
24395628 Elevation of serum PAPP-A has been found in hemodialysis patients and its significant correlation with bicarbonate suggests that it may be a prognostic factor.
24338604 Time-to-pregnancy >/=24 months in spontaneously conceived pregnancies is associated with decreased levels of PAPP-A and free beta-hCG.
24312907 PAPP-A is produced and secreted in surprisingly high amounts by human adult cardiac progenitor cells.
24304164 no association between prior pre-eclampsia and first trimester pregnancy level
24227626 Serum PAPP-A levels were closely associated with the coronary no-reflow phenomenon during percutaneous coronary intervention.
24226839 Maternal serum PAPP-A was not associated with fetal open spina bifida.
24226752 Increased PAPP-A in the first trimester is associated with placenta accreta.
24201068 Despite the relation of CT-IGFBP4 to a more severe coronary artery disease, CT- and NT-IGFBP4, in contrast to our report based on total PAPP-A, failed to predict any long-term outcomes in patients with stable cardiovascular disease.
24188108 In AKI patients, PAPP-A, EN-RAGE and HMGB1 are elevated, but sRAGE and PlGF are not increased.
24171308 The current findings suggest an important role of PAPP-A in regulation of bioavailability of IGF-I, VEGF, activated forms of NF-kappaB, and alpha-subunits of HIF-1 in endometrial tumors.
24155168 Elevated PAPP-A was associated with fetal macrosomia.
24151105 Results show a lack of a direct association between SELE rs5355C>T gene polymorphism, serum PAPP-A level and intima-media thickness in patients with end-stage renal disease.
24107527 higher levels associated with coronary plsque instability
24099568 Findings indicate that the CC genotype of rs13290387 within PAPP-A is associated with an increased risk of ischemic stroke in northern Chinese Han populations
24069146 MIC-1 and PAPP-A levels are significantly depressed in women presenting to EPAU with ultrasound evidence of fetal viability, but later miscarry.
24060054 PAPP-A and IGFBP-4 gene expression (microarray analysis) was significantly upregulated in IL-1beta- or TNF-alpha-exposed cells.
23891271 Among assisted conceptions, only nondonor IVF/ICSI singleton pregnancies need adjustments of the maternal serum PAPP-A in first-trimester Down syndrome screening.
23891063 Elevated ischemia-modified albumin serum levels together with low levels of PAPP-A are detected in the first trimester in mothers bearing small-for-gestational-age fetuses.
23881937 elevated PAPP-A expression in glomeruli is associated with diabetic nephropathy in humans
23880622 PAPPA can be used as a novel biomarker for the diagnosis of sepsis-related myocardial dysfunction and the prediction of outcomes in critically ill patients.
23821525 inhibition of miR0-490-3p up-regulated its target gene PAPP-A and then increased the proteolysis of IGFBP-4
23795813 Strong correlations were found between umbilical cord measurement at umbilicus versus serum PAPP-A during first trimester of pregnancy.
23795618 In pregnant women with inherited thrombophilia, PAPP-A levels were significantly higher and fbHCG levels were lower during the first trimester.
23756051 Data suggest that placentation (here, basal plate surface area of placenta) and maternal serum PAPP-A are significantly lower and maternal serum inhibin A/alpha subunit is significantly higher in pre-eclampsia than in control subjects.
23654313 Low serum PAPP-A is a marker for poor pregnancy outcome.
23642968 Low PAPP-A was strongly associated with GDM and lower values were found in diabetic women needing insulin therapy
23569011 High serum PAPP-A and plaque lesions with a large necrotic core are associated with the no-reflow phenomenon after percutaneous coronary intervention, in patients with unstable angina.
23461814 Low PAPP-A during the first trimester is a predictive factor for breech presentation at term of pregnancy.
23169786 Differential effects of chronic (transgenic) and transient (endogenous) PAPP-A expression on neointimal formation following vascular injury that may be due in part to the differential impact on IGF-I signaling.
23152806 PAPPA secretion may play an important role in lung cancer growth and progression.
23122949 Identification of novel molecules associated with a LIF-mediated increase in trophoblastic cell invasion may facilitate our understanding of implantation biology.
23010598 Data suggest progressive down-regulation of PAPPA in placenta with gestational age; homodimeric PAPPA is mainly negative in syncytium and positive in villous cytotrophoblast; PAPPA is released only by first trimester placental explants in culture.
22954283 Data suggest that women who develop gestational diabetes mellitus (GDM) have significantly lower pregnancy-associated plasma protein-A (PAPP-A) as detected in first-trimester screening. Plasma PAPP-A is a possible biological marker for GDM.
22940118 Adiponectin concentration was negatively correlated with maternal smoking status and positively correlated with levels of insulin and PAPP-A
22836155 Study highlights the utility of both CRP and PAPP-A levels as determinants of plaque instability in acute coronary syndrome.
22783577 Serum MMP-2 and PAPP-A were independent correlates of proteinuria, albumin, and other examined parameters in patients with chronic kidney disease.
22709655 exogenous PAPP-A can promote recovery of muscle injury in aging mice albeit the expression of endogenous PAPP-A had already been increased dramatically upon muscle injury
22644835 Data suggest that serum PAPP-A level in adult subjects with growth hormone deficiency is significantly higher than in control subjects; serum PAPP-A levels appear to be related to atherosclerosis risk factors.
22630333 Tobacco smoking during pregnancy decreases the pregnancy-associated plasma protein A and insulin growth factors I and II levels.
22395770 High positive predictive value of PAPP-A for acute coronary syndrome diagnosis in heparin-naive patients
22377654 Serum-free beta-hCG and PAPP-A concentrations at 9-13 weeks' gestation are affected by several pregnancy characteristics in Afro-Caribbean women.
22367671 Pregnancy-associated plasma protein A and free-beta-hCG values are gestational age specific.
22365285 Ethnic group-specific median for PAPP-A should be incorporated during first-trimester screening for fetal Down syndrome; equation of best fit was predicted median PAPP-A level=28.767 - 0.781x(gestational age in days)+0.006x(gestational age in days)2.
22148978 serum concentration did not differ significantly between pregnancies complicated by preeclampsia and uncomplicated pregnancies
22123284 Increased PAPP-A is a significant independent predictor of overall mortality and mortality due to infection in long-term hemodialysis patients.
22015022 secretion of PAPP-A, ADAM12 and PP13 is closely related to the size of the placenta in the beginning of pregnancy. After 8 weeks of pregnancy, which is the time for luteoplacental shift, the correlation disappears.
21986593 Our study indicates the association of TT genotype of Cys327Cys polymorphism of the PAPP-A gene with preeclampsia
21781597 PAPP-A was associated with instability of culprit plaque in unstable angina patients.
21779191 The patients with acute myocardial infarction had higher levels of plasma pregnancy-associated plasma protein A with sensitivity and specificity 65% and 87%.
21753069 increased PAPPA levels might reflect an indirect mechanism of PAPPA with cardiovascular risk factors such as serum lipids rather than a direct effect on the vasculature
21717483 Screening performance of serum PAPP-A is poor for both early-onset pre-eclampsia and intra-uterine growth restriction.
21631965 Pregnancy-associated plasma protein a polymorphisms in patients with risk pregnancies
21557695 decreased in preterm labor, level < 29.8 mIU/ml associated with increased risk for preterm birth
21427871 Low PAPP-A levels in the first trimester were associated with a low prognostic value for development of preeclampsia and early preeclampsia before 34th weeks of gestation.
21360961 The review summarizes possible mechanisms relating tobacco smoking to the changes of PAPP-A concentration during pregnancy.
21360554 Hyperemesis gravidarum is associated with elevated levels of PAPP-A and free beta-hCG, and such changes are independent of serum indicators of thyroid and liver function.
21324404 First-trimester PAPP-A levels are associated with abnormal placental morphometry at delivery in pregnancies with pre-eclampsia and intrauterine growth retardation.
21290395 Umbilical cord insertion on the lower segment of the uterus is associated with low maternal serum PAPP-A levels.
21111564 PAPP-A level was significantly related to soluble and membrane-bound OX40L in patients with ACS.
21093861 Pregnancy associated plasma protein-A may have a role in myocardial infarction and death in patients with stable coronary artery disease
20865665 The percentage of PAPP-A positive cells in both the outer and inner annulus correlated significantly with increasing stages of disc degeneration
20734665 Adverse pregnancy outcome can be predicted by first-trimester maternal serum PAPP-A.
20716560 Observational study of gene-disease association. (HuGE Navigator)
20583170 Observational study of gene-disease association. (HuGE Navigator)
20515576 High serum PAPP-A is associated with acute coronary syndrome and unstable angina.
20509148 Low levels of PAPP-A are associated not only with low birth weight at term but also with slower fetal growth prior to 20weeks of gestation.
20472761 Conclude that expression of human PAPP-A localized to arterial smooth muscle accelerates lesion progression in a mouse model of atherosclerosis.
20388505 In patients admitted with chest pain and both normal ECG and normal biomarkers PAPP-A seems to be valuable for predicting patients at high risk of death or non-fatal myocardial infarction
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20148724 PAPP-A was an independent predictor of 5-year all-cause mortality in patients with symptomatic peripheral artery disease.
20087924 PAPP-A < or =10th percentile is associated with an increased risk for preterm birth, but is not sufficiently predictive to be used clinically.
19862778 appears to be a useful marker for neonatal outcome in patients diagnosed with second trimester fetal growth restriction
19842999 Low levels of serum PAPP-A may be a potential resource in order to early screen pregnant women at increased risk of hypertension in pregnancy.
19842139 increased levels in pregnant women with a previous trisomy 21 or trisomy 13
19781342 In coronary arteries, COX-2 and PAPP-A play a role in the pathogenesis of acute coronary syndrome.
19646567 Low PAPP-A levels at first-trimester screening are associated independently with higher rates of emergency CS for nonreassuring fetal status during labor and lower pH
19365167 Data show that the serum PAPP-A levels increased in patients with lung cancer and postulated that PAPP-A levels may be a prognostic factor in such cases.
19328196 The present study examined whether PAPP-A measured in an emergency department (ED) chest pain population in association with conventional and novel high sensitivity cTn (hs-cTnI) assays can predict long-term mortality.
19318028 PAPP-A seems to be a marker ischaemia both acute coronary syndrome, possibly due to the release of PAPP-A from the vulnerable plaque.
19304869 Serum PAPP-A and IGF1 do not appear to be useful serum biomarkers for carotid atherosclerosis in type 2 diabetic patients with stable glycemic control, despite scientific evidence of their local role in atherosclerosis.
19246276 Angiotensin II can time- and dose-dependently induce PAPP-A and IGF-1 mRNA expression in human umbilical artery smooth muscle cells.
19173346 Monochorionic twins have a significantly lower serum free beta-hCG (beta human chorionic gonadotropin) and a significantly lower PAPP-A(pregnancy-associated plasma protein A) compared to dichorionic
19106261 Median values in pregnant smokers versus nonsmokers does not affect diagnosis of Down syndrome in the first trimester.
19003798 Early prediction of fetuses being SGA is feasible with the combination of first trimester PAPP-A, beta-hCG and ADAM12.
18925584 Women with a low PAPP-A early in their pregnancy have twice the risk of an adverse outcome, though PAPP-A as a one-time single marker test has limited value.
18855223 PAPP-A serum levels increase above normal values within 24 h after onset of symptoms in acute coronary syndromes.
18805800 Maternal serum concentrations of PAPP-A were not significantly elevated in pre-eclampsia as compared with uncomplicated pregnancy
18789800 PAPP-A has a role as a marker of cardiovascular risk [review]
18552658 Production of PAPP-A by disc cells is important since PAPP-A cleaves IGF-binding proteins, and makes IGF-I, a potent mitogen and antiapoptotic agent, available to cells.
18434323 the proteolytic activity of pregnancy-associated plasma protein-A is inhibited by targeting substrate exosite binding
18377765 PAPP-A and IGF-1 are elevated in patients with acute coronary syndrome
18295168 First-trimester pregnancy-associated plasma protein A has a positive relationship with birth weight. As PAPP-A decreases, the rigk of small-for-gestational age infants increases.
18279673 PAPP-A levels seem to be a potentially highly specific marker for heart disease.
18267116 high PAPP-A levels (>4.8 mIU/L) showed an association with all-cause mortality during long-term follow-up of chronic stable angina patients; study showed existence of a threshold effect of PAPP-A levels that may be useful in predicting clinical outcome
18089325 PAPP-A level is elevated in renal transplant patients and high levels of PAPP-A may be a prognostic marker associated with high serum levels of urea, creatinine, uric acid, and C-reactive protein.
17936662 Human coronary artery ECs express PAPP-A mRNA and functional protein when activated by the pro-inflammatory cytokine, TNF-alpha
17714879 Patients with hyperechoic or isoechoic carotid plaques exhibit significantly higher PAPP-A levels than those with hypoechoic early carotid lesions.
17700210 PAPP-A IVS6+95 C allele is an independent risk factor for acute myocardial infarction even after adjustment for traditional risk factors.
17565927 PAPP-A may contribute to airway smooth muscle hyperplasia
17516846 Phage display was used to discover fully human antibody inhibitors of PAPP-A activity towards IGFBP4 cleavage
17509577 Maternal serum PAPP-A levels in the late first trimester of pregnancy are associated with subsequent fetal growth,both physiologic variation and abnormal growth.
17437322 Maternal systemic lupus erythematosus does not affect first trimester level.
17314100 PAPP-A2 LNR1-2, but not LNR3, are functionally conserved with respect to insulin-like growth factor -binding proteins proteolysis
17237617 We demonstrated that after successful TX, PAPP-A and sRAGE decrease and early chronic vascular changes in the kidney TX are associated with elevation of their serum levels.
17223728 Proform eosinophilic major basic protein is involved in processes preceding vulnerable plaque development in acute coronary syndrome.
17177834 the IGF system may have a limited role in the pathogenesis of GCT with PAPP-A subserving a function other than IGFBP-4 proteolysis
17145752 PAPP-A requires the formation of intermolecular proteinase-inhibitor disulfide bonds and glycosaminoglycan covalently bound to the inhibitor
16963045 Preliminary evidence suggests that first-trimester uterine artery Doppler measurements do not correlate with maternal serum levels of free beta-hCG and PAPP-A.
16959807 PAPP-A may be involved in the regulation of bone development in the first trimester.
16388849 We suggest that PPARgamma-mediated inhibition of PAPP-A might decrease the amount of bioactive IGFII, a factor known to promote trophoblast invasion.
16115888 PAPP-A increased the proliferation and differentiation of myoblasts, its myogenic effect is governed by its proteolytic activity, and it promotes skeletal myogenesis by increasing the amount of free IGFs.
16086443 maternal serum PAPP-A at 11-13(+6) of gestation is significantly lower in adverse pregnancy outcomes
15919757 PAPP-A functions in the formation of mineralized tissues through direct up-regulation of key genes and is involved in the formation of new blood vessels, which is essential for proper bone regeneration
15754336 findings underscore a novel mechanism whereby glucocorticoids increase IGF responses in bone cells via PAPP-A-induced IGFBP-4 proteolysis
15647258 the proform of eosinophil major basic protein inhibits the proteolytic activity of PAPP-A
15305104 women who experienced spontaneous abortions had significantly different mean PAPP-A serum levels at 10(+1) to 14(+6) weeks gestation
15262980 PAPPA Lin12-notch repeats bind calcium and determine its proteolytic specificity
15146551 PAPP-A and proMBP are regulated in malignant ovarian epithelial cells,altering IGFBP-4 proteolysis and local regulation of IGF availability
14988014 Proform of eosinophil major basic protein forms a covalent complex with PAPPA in which PAPPA is inhibited.
14705967 Partially purified PAPP-A400 exhibited a 4-fold reduction in IGFBP-4 proteolytic activity compared with PAPP-A470. A novel mechanism, conversion of PAPP-A470 to the less-active PAPP-A400, could account for the TPA-induced suppression of PAPP-A activity.
14657012 PAPP-A expression is regulated by inflammatory cytokines in adult human fibroblasts, with functional consequences on IGFBP-4 protease activity and IGF-I bioavailability
14530192 Plasma PAPP-A, a zinc-binding matrix metalloproteinase, is a strong independent predictor of ischemic cardiac events and need of revascularization in patients who present with suspected myocardial infarction but remain troponin negative
12970325 PAPP-A may play an important role in an integrated insulin-like growth factor system in wound healing and tissue remodeling in vivo
12817760 TGF-beta and IGF-II in the bone microenvironment coordinately amplify IGF-I bioavailability through controlled IGFBP-4 protease, which may be a means to promote bone formation.
12524241 Elevated serum PAPP-A levels represent a potential marker of the degree of echogenicity of carotid atherosclerotic plaques in asymptomatic hyperlipidemic patients at high cardiovascular risk.
12421832 PAPP-A's structure is described, and its ability to dimerize and to bind to pro-major basic protein with disulfide bonds explained
12414897 data demonstrate the presence of an IGF-II- and metal-dependent IGFBP-4 protease activity in human trophoblast plasma membranes, identified as PAPP-A
12370176 IGF bioactivity is regulated by reversible cell surface binding of PAPP-A, which in turn is regulated by proMBP
12241545 substrate specificity of the metalloproteinase pregnancy-associated plasma protein-A (PAPP-A) assessed by mutagenesis and analysis of synthetic peptides
12213189 the PAPP-A mRNA level in mouse placenta was lower compared to that in human placenta by at least two orders of magnitude
12087395 association of maternal PAPP-A levels and fetal growth/birth weight
11914564 Fetal trisomies 21, 18, and 13 are associated with a reduction in second-trimester maternal PAPP-A levels
11897673 phorbol ester tumor promoters and simian virus 40 transformation regulate IGFBP-4 proteolysis in human fibroblasts through induction of a novel inhibitor of PAPP-A, pro-MBP

AA Sequence

MRLWSWVLHLGLLSAALGCGLAERPRRARRDPRAGRPPRPAAGPATCATRAARGRRASPPPPPPPGGAWE      1 - 70
AVRVPRRRQQREARGATEEPSPPSRALYFSGRGEQLRLRADLELPRDAFTLQVWLRAEGGQRSPAVITGL     71 - 140
YDKCSYISRDRGWVVGIHTISDQDNKDPRYFFSLKTDRARQVTTINAHRSYLPGQWVYLAATYDGQFMKL    141 - 210
YVNGAQVATSGEQVGGIFSPLTQKCKVLMLGGSALNHNYRGYIEHFSLWKVARTQREILSDMETHGAHTA    211 - 280
LPQLLLQENWDNVKHAWSPMKDGSSPKVEFSNAHGFLLDTSLEPPLCGQTLCDNTEVIASYNQLSSFRQP    281 - 350
KVVRYRVVNLYEDDHKNPTVTREQVDFQHHQLAEAFKQYNISWELDVLEVSNSSLRRRLILANCDISKIG    351 - 420
DENCDPECNHTLTGHDGGDCRHLRHPAFVKKQHNGVCDMDCNYERFNFDGGECCDPEITNVTQTCFDPDS    421 - 490
PHRAYLDVNELKNILKLDGSTHLNIFFAKSSEEELAGVATWPWDKEALMHLGGIVLNPSFYGMPGHTHTM    491 - 560
IHEIGHSLGLYHVFRGISEIQSCSDPCMETEPSFETGDLCNDTNPAPKHKSCGDPGPGNDTCGFHSFFNT    561 - 630
PYNNFMSYADDDCTDSFTPNQVARMHCYLDLVYQGWQPSRKPAPVALAPQVLGHTTDSVTLEWFPPIDGH    631 - 700
FFERELGSACHLCLEGRILVQYASNASSPMPCSPSGHWSPREAEGHPDVEQPCKSSVRTWSPNSAVNPHT    701 - 770
VPPACPEPQGCYLELEFLYPLVPESLTIWVTFVSTDWDSSGAVNDIKLLAVSGKNISLGPQNVFCDVPLT    771 - 840
IRLWDVGEEVYGIQIYTLDEHLEIDAAMLTSTADTPLCLQCKPLKYKVVRDPPLQMDVASILHLNRKFVD    841 - 910
MDLNLGSVYQYWVITISGTEESEPSPAVTYIHGSGYCGDGIIQKDQGEQCDDMNKINGDGCSLFCRQEVS    911 - 980
FNCIDEPSRCYFHDGDGVCEEFEQKTSIKDCGVYTPQGFLDQWASNASVSHQDQQCPGWVIIGQPAASQV    981 - 1050
CRTKVIDLSEGISQHAWYPCTISYPYSQLAQTTFWLRAYFSQPMVAAAVIVHLVTDGTYYGDQKQETISV   1051 - 1120
QLLDTKDQSHDLGLHVLSCRNNPLIIPVVHDLSQPFYHSQAVRVSFSSPLVAISGVALRSFDNFDPVTLS   1121 - 1190
SCQRGETYSPAEQSCVHFACEKTDCPELAVENASLNCSSSDRYHGAQCTVSCRTGYVLQIRRDDELIKSQ   1191 - 1260
TGPSVTVTCTEGKWNKQVACEPVDCSIPDHHQVYAASFSCPEGTTFGSQCSFQCRHPAQLKGNNSLLTCM   1261 - 1330
EDGLWSFPEALCELMCLAPPPVPNADLQTARCRENKHKVGSFCKYKCKPGYHVPGSSRKSKKRAFKTQCT   1331 - 1400
QDGSWQEGACVPVTCDPPPPKFHGLYQCTNGFQFNSECRIKCEDSDASQGLGSNVIHCRKDGTWNGSFHV   1401 - 1470
CQEMQGQCSVPNELNSNLKLQCPDGYAIGSECATSCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCT   1471 - 1540
AGLKWYPHPALIHCVKGCEPFMGDNYCDAINNRAFCNYDGGDCCTSTVKTKKVTPFPMSCDLQGDCACRD   1541 - 1610
PQAQEHSRKDLRGYSHG                                                        1611 - 1627
//

Text Mined References (199)

PMID Year Title
27125092 INTRAUTERINE GROWTH RESTRICTION--PREDICTIVE SERUM MARKERS.
26823756 2015 MicroRNA-141 inhibits vascular smooth muscle cell proliferation through targeting PAPP-A.
26697810 2016 First-trimester maternal serum ADAM12-s and PAPP-A levels are altered in pregnancies conceived after assisted reproduction techniques (ART).
26362726 2015 First-trimester biochemical markers of placentation in screening for gestational diabetes mellitus.
26336825 2015 PAPP-A proteolytic activity enhances IGF bioactivity in ascites from women with ovarian carcinoma.
26297643 2015 Pregnancy-associated plasma protein A in human ovarian follicles and its association with intrafollicular hormone levels.
26223809 2015 The utility of pregnancy-associated plasma protein A for determination of prognosis in a cohort of patients with coronary artery disease.
26214492 2015 Correlation of plasma soluble cluster of differentiation 40 ligand, alpha fetoprotein A, and pregnancy-associated plasma protein A with carotid plaque in patients with ischemic stroke.
26122709 2015 Correlation of single nucleotide polymorphisms in the pregnancy-associated plasma protein-A gene with carotid plaques.
26020769 2015 Causal Modeling of Cancer-Stromal Communication Identifies PAPPA as a Novel Stroma-Secreted Factor Activating NF?B Signaling in Hepatocellular Carcinoma.
25858516 2015 Effect of ethnicity on first trimester biomarkers for combined trisomy 21 screening: results from a multicenter study in six Asian countries.
25846403 2015 First trimester screening for Down syndrome using nuchal translucency, maternal serum pregnancy-associated plasma protein A, free-? human chorionic gonadotrophin, placental growth factor, and ?-fetoprotein.
25720282 [Expression and activity of proteases in metastasis of ovarian cancer].
25639820 2015 First trimester maternal serum biochemical markers of aneuploidy in pregnancies with abnormally invasive placentation.
25633269 2015 First trimester placental retinol-binding protein 4 (RBP4) and pregnancy-associated placental protein A (PAPP-A) in the prediction of early-onset severe pre-eclampsia.
25596909 2015 Evaluation of the role of maternal serum high-sensitivity C-reactive protein in predicting early pregnancy failure.
25543334 2014 Pattern of secretion of pregnancy-associated plasma protein-A (PAPP-A) during pregnancies complicated by fetal aneuploidy, in vivo and in vitro.
25468445 2014 Pregnancy-associated plasma protein-A expression in human breast cancer.
25395363 2015 First-trimester combined screening for trisomy 21 in women with renal disease.
25316741 2014 Low pregnancy-associated plasma protein A level in the first trimester.
25238218 2014 Novel cardiovascular biomarkers in women with a history of early preeclampsia.
25159705 2015 First-trimester screening biochemical markers (free beta-subunit human chorionic gonadotropin, pregnancy-associated plasma protein-A) and risk of early fetal loss.
25139218 2015 Maternal serum PAPP-A as an early marker of obstetric complications?
25108075 2014 Pregnancy-associated plasma protein A associates with cardiovascular events in diabetic hemodialysis patients.
25016703 2014 Growth differentiation factor 15, ischemia modified albumin and pregnancy-associated plasma protein A in patients with coronary artery disease.
24940710 2015 Correlation of neonatal weight with maternal serum levels of pregnancy-associated plasma protein-A during the first trimester of pregnancy: a retrospective study.
24931331 2014 Pregnancy-associated plasma protein A regulates mitosis and is epigenetically silenced in breast cancer.
24817938 2014 Pregnancy-associated plasma protein A up-regulated by progesterone promotes adhesion and proliferation of trophoblastic cells.
24800985 2014 Genome-wide association study of maternal and inherited loci for conotruncal heart defects.
24786703 2014 Can first trimester placental protein-13 and pregnancy-associated plasma protein-A predict pre-eclampsia in Turkish women?
24743523 2014 Prediction of large-for-gestation neonates with first-trimester maternal serum PAPP-A.
24667032 2014 Cys327Cys polymorphism of the PAPP-A gene (pregnancy associated plasma protein A) is related to mortality of long term hemodialysis patients.
24395628 2014 Association between serum pregnancy-associated plasma protein-A and bicarbonate in hemodialysis patients.
24338604 2014 Longer time-to-pregnancy in spontaneously conceived pregnancies is associated with lower PAPP-A and free ?-hCG in first trimester screening for Down syndrome.
24312907 2013 Analysis of pregnancy-associated plasma protein A production in human adult cardiac progenitor cells.
24304164 2014 First trimester maternal characteristics, Doppler parameters and serum analytes after preeclampsia.
24227626 2015 A combination of plaque components analyzed by integrated backscatter intravascular ultrasound and serum pregnancy-associated plasma protein a levels predict the no-reflow phenomenon during percutaneous coronary intervention.
24226839 2014 First trimester maternal serum alpha-fetoprotein is not raised in pregnancies with open spina bifida.
24226752 2014 Elevated first trimester PAPP--a is associated with increased risk of placenta accreta.
24201068 2014 Clinical differences between total PAPP-A and measurements specific for the products of free PAPP-A activity in patients with stable cardiovascular disease.
24188108 2013 Placental growth factor, pregnancy-associated plasma protein-A, soluble receptor for advanced glycation end products, extracellular newly identified receptor for receptor for advanced glycation end products binding protein and high mobility group box 1 levels in patients with acute kidney injury: a cross sectional study.
24171308 [Relationship between the expression levels of PAPP-A metalloproteinase and growth and transcriptional factors in endometrial cancer].
24155168 2014 High macrosomia rate in healthy fetuses after enlarged nuchal translucency.
24151105 2014 Association of E-selectin gene polymorphism and serum PAPP-A with carotid atherosclerosis in end-stage renal disease.
24107527 2013 Pregnancy-associated plasma protein-A as a marker of culprit lesion instability in unstable angina patients: an intravascular ultrasound study.
24099568 2014 Association of pregnancy-associated plasma protein-A gene polymorphism with ischemic stroke in northern Chinese Han population.
24069146 2013 Plasma MIC-1 and PAPP-a levels are decreased among women presenting to an early pregnancy assessment unit, have fetal viability confirmed but later miscarry.
24060054 2013 Human annulus cells regulate PAPP-A and IGFBP-4 expression, and thereby insulin-like growth factor bioavailability, in response to proinflammatory cytokine exposure in vitro.
23891271 2013 Additive effect of factors related to assisted conception on the reduction of maternal serum pregnancy-associated plasma protein A concentrations and the increased false-positive rates in first-trimester Down syndrome screening.
23891063 2013 Ischemia-modified albumin in pregnancy.
23881937 2013 Mice deficient in PAPP-A show resistance to the development of diabetic nephropathy.
23880622 2014 Elevated pregnancy-associated plasma protein A predicts myocardial dysfunction and death in severe sepsis.
23821525 2013 MiR-490-3p modulates the proliferation of vascular smooth muscle cells induced by ox-LDL through targeting PAPP-A.
23795813 2014 Relation between serum PAPP-A level and umbilical cord thickness during first trimester of pregnancy.
23795618 2014 The impact of inherited thrombophilia on first trimester combined aneuploidy screening test parameters.
23756051 2013 2D-Ultrasound and endocrinologic evaluation of placentation in early pregnancy and its relationship to fetal birthweight in normal pregnancies and pre-eclampsia.
23654313 2013 Low pregnancy associated plasma protein-A in the 1st trimester: is it a predictor of poor perinatal outcome?
23642968 2013 Gestational diabetes mellitus: including serum pregnancy-associated plasma protein-A testing in the clinical management of primiparous women? A case-control study.
23569011 2013 Plaque characteristics and serum pregnancy-associated plasma protein A levels predict the no-reflow phenomenon after percutaneous coronary intervention.
23461814 2013 First trimester PAPP-A MoM values predictive for breech presentation at term of pregnancy.
23169786 2013 Constitutive expression of pregnancy-associated plasma protein-A in arterial smooth muscle reduces the vascular response to injury in vivo.
23152806 2012 Protein secretion is required for pregnancy-associated plasma protein-A to promote lung cancer growth in vivo.
23122949 2013 Leukemia inhibitory factor increases the invasiveness of trophoblastic cells through integrated increase in the expression of adhesion molecules and pappalysin 1 with a concomitant decrease in the expression of tissue inhibitor of matrix metalloproteinases.
23010598 2012 Homodimeric pregnancy-associated plasma protein-A in normal human placenta of first and third trimester of pregnancy: biochemical and morphological observations.
22954283 2013 Can first-trimester screening program detect women at high risk for gestational diabetes mellitus?
22940118 2012 Second trimester amniotic fluid adiponectin level is affected by maternal tobacco exposure, insulin, and PAPP-A level.
22836155 2012 Assessment of serum leptin, pregnancy-associated plasma protein A and CRP levels as indicators of plaque vulnerability in patients with acute coronary syndrome.
22783577 2012 Determinants of circulating matrix metalloproteinase-2 and pregnancy-associated plasma protein-A in patients with chronic kidney disease.
22709655 2012 Transgenic overexpression of pregnancy-associated plasma protein-A in skeletal muscle of mice increases myofiber size and central nucleation in sedentary muscle and promotes muscle regeneration in the injured muscle.
22644835 2012 Increase in serum pregnancy-associated plasma protein-A is correlated with increase in cardiovascular risk factors in adult patients with growth hormone deficiency.
22630333 2012 The pregnancy-associated plasma protein A and insulin-like growth factor system in response to cigarette smoking.
22395770 2012 High positive predictive value of PAPP-A for acute coronary syndrome diagnosis in heparin-naïve patients.
22377654 2012 Temporal effect of Afro-Caribbean race on serum pregnancy-associated plasma protein-a at 9-13 weeks' gestation in screening for aneuploidies.
22367671 2012 Early first-trimester free-?-hCG and PAPP-A serum distributions in monochorionic and dichorionic twins.
22365285 2012 Median levels of serum biomarkers of fetal Down syndrome detected during the first trimester among pregnant Thai women.
22148978 2012 ?hCG and PAPP-A in first trimester: predictive factors for preeclampsia?
22123284 2012 Pregnancy-associated plasma protein A as an independent mortality predictor in long-term hemodialysis patients.
22015022 2011 The secretion of PAPP-A, ADAM12, and PP13 correlates with the size of the placenta for the first month of pregnancy.
21986593 2011 Association of pregnancy-associated plasma protein A polymorphism with preeclampsia - a pilot study.
21781597 2011 [Evaluation on the relationship between pregnancy associated plasma protein-a and intravascular ultrasound detected culprit coronary plaque morphology in patients with unstable angina].
21779191 2011 Diagnostic performance of high-sensitivity troponin T, myeloperoxidase, and pregnancy-associated plasma protein A assays for triage of patients with acute myocardial infarction.
21753069 2011 Pregnancy-associated plasma protein A in obese children: relationship to markers and risk factors of atherosclerosis and members of the IGF system.
21717483 2011 First trimester screening for intra-uterine growth restriction and early-onset pre-eclampsia.
21631965 2011 Pregnancy-associated plasma protein A polymorphisms in patients with risk pregnancies.
21557695 2011 Late pregnancy associated plasma protein A levels decrease in preterm labor.
21427871 2010 [Low PAPP-A levels between 11 and 13(+6) weeks of gestation and the risk of preeclampsia].
21360961 2010 [The influence of tobacco smoking on concentration of the pregnancy-associated plasma protein A (PAPP-A) in pregnant women].
21360554 2011 First trimester maternal serum PAPP-A and free ?-HCG levels in hyperemesis gravidarum.
21324404 2011 First-trimester serum analytes, biophysical tests and the association with pathological morphometry in the placenta of pregnancies with preeclampsia and fetal growth restriction.
21290395 2011 Umbilical cord insertion into the lower segment of the uterus at 11 to 13 weeks' gestation is associated with maternal serum PAPP-A.
21111564 2011 Positive correlation between pregnancy-associated plasma protein-A level and OX40 ligand expression in patients with acute coronary syndromes.
21093861 2011 Pregnancy associated plasma protein-A as a marker for myocardial infarction and death in patients with stable coronary artery disease: a prognostic study within the CLARICOR Trial.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20865665 2010 The relationship between pregnancy-associated plasma protein-A (PAPP-A) and human intervertebral disc degeneration.
20734665 2010 [Prediction of adverse pregnancy outcome by first-trimester maternal serum PAPP-A].
20716560 2010 Genetic variation within the hypothalamus-pituitary-ovarian axis in women with recurrent miscarriage.
20583170 2010 Follow-up association studies of chromosome region 9q and nonsyndromic cleft lip/palate.
20515576 A pilot study of the clinical relevance of the relationship between the serum level of pregnancy-associated plasma protein A and the degree of acute coronary syndrome.
20509148 2010 Low PAPP-A in the first trimester is associated with reduced fetal growth rate prior to gestational week 20.
20472761 2010 Transgenic overexpression of pregnancy-associated plasma protein-A in murine arterial smooth muscle accelerates atherosclerotic lesion development.
20388505 2010 Pregnancy-associated plasma protein-A, a marker for outcome in patients suspected for acute coronary syndrome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20148724 2010 Pregnancy-associated plasma protein-A as a marker for long-term mortality in patients with peripheral atherosclerosis: inconclusive findings from the Linz Peripheral Arterial Disease (LIPAD) study.
20087924 2010 Association of first-trimester low PAPP-A levels with preterm birth.
19862778 2009 First trimester pregnancy associated plasma protein-A as a marker for poor pregnancy outcome in patients with early-onset fetal growth restriction.
19842999 2009 First trimester PAPP-A levels associated with early prediction of pregnancy induced hypertension.
19842139 2009 Maternal serum screening marker levels in women with a previous aneuploidy pregnancy.
19781342 2009 [Expression of COX-2 and pregnancy associate plasma protein A in coronary arteries and their relationship with acute coronary syndrome: an autopsy study of 42 cases].
19646567 2009 First-trimester maternal serum screening and the risk for fetal distress during labor.
19365167 2009 Relationship between pregnancy-associated plasma protein-A and lung cancer.
19328196 2009 PAPP-A as a marker of increased long-term risk in patients with chest pain.
19318028 2009 Pregnancy associated plasma protein A, a potential marker for vulnerable plaque in patients with non-ST-segment elevation acute coronary syndrome.
19304869 2009 Association of the IGF1/pregnancy-associated plasma protein-A system and adipocytokine levels with the presence and the morphology of carotid plaques in type 2 diabetes mellitus patients with stable glycaemic control.
19246276 2009 [Effect of angiotensin II on pregnancy-associated plasma protein A and insulin-like growth factor 1 gene expression in human umbilical artery smooth muscle cells].
19173346 2009 Early first-trimester free beta-hCG and PAPP-A serum distributions in monochorionic and dichorionic twins.
19106261 2008 First trimester Down's syndrome screening marker values and cigarette smoking: new data and a meta-analysis on free beta human chorionic gonadotophin, pregnancy-associated plasma protein-A and nuchal translucency.
19003798 2008 First trimester maternal serum PAPP-A, beta-hCG and ADAM12 in prediction of small-for-gestational-age fetuses.
18925584 2008 Low levels of maternal serum PAPP-A in early pregnancy and the risk of adverse outcomes.
18855223 2009 Release patterns of pregnancy-associated plasma protein A in patients with acute coronary syndromes assessed by an optimized monoclonal antibody assay.
18805800 2008 Increased levels of pregnancy-associated plasma protein-A2 in the serum of pre-eclamptic patients.
18789800 2009 Pregnancy-associated plasma protein-A (PAPP-A) and cardiovascular risk.
18552658 2008 Immunolocalization and biochemical evidence of pregnancy-associated plasma protein A in the intervertebral disc.
18434323 2008 Inhibition of the proteolytic activity of pregnancy-associated plasma protein-A by targeting substrate exosite binding.
18391950 2008 Identification of ten loci associated with height highlights new biological pathways in human growth.
18377765 2008 Levels of pregnancy-associated plasma protein A in patients with coronary artery disease.
18295168 2008 First-trimester pregnancy-associated plasma protein A and subsequent abnormalities of fetal growth.
18279673 2008 Pregnancy-associated plasma protein A in non-cardiac conditions.
18267116 2008 Prognostic value of circulating pregnancy-associated plasma protein-A (PAPP-A) and proform of eosinophil major basic protein (pro-MBP) levels in patients with chronic stable angina pectoris.
18089325 2007 Pregnancy-associated plasma protein-A: evaluation of a new biomarker in renal transplant patients.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17936662 2008 Differential regulation of pregnancy associated plasma protein-A in human coronary artery endothelial cells and smooth muscle cells.
17714879 2008 PAPP-A: a possible pathogenic link to the instability of atherosclerotic plaque.
17700210 2007 Genetic polymorphism in the pregnancy-associated plasma protein-A associated with acute myocardial infarction.
17565927 Pregnancy-associated plasma protein-A and asthma.
17516846 2007 Discovery and characterization of human antibody inhibitors of pregnancy-associated plasma protein-A.
17509577 2008 Association between birth weight and first-trimester free beta-human chorionic gonadotropin and pregnancy-associated plasma protein A.
17437322 2007 Influence of maternal systemic lupus erythematosus on first-trimester combined screening for chromosomal abnormalities.
17314100 2007 A substrate specificity-determining unit of three Lin12-Notch repeat modules is formed in trans within the pappalysin-1 dimer and requires a sequence stretch C-terminal to the third module.
17237617 2007 Pregnancy-associated plasma protein a and soluble receptor for advanced glycation end products after kidney transplantation.
17223728 2008 Pregnancy-associated plasma protein A and proform eosinophilic major basic protein in the detection of different types of coronary artery disease.
17177834 Insulin-like growth factor, insulin-like growth factor-binding protein-4, and pregnancy-associated plasma protein-A gene expression in human granulosa cell tumors.
17145752 2007 Cell surface detachment of pregnancy-associated plasma protein-A requires the formation of intermolecular proteinase-inhibitor disulfide bonds and glycosaminoglycan covalently bound to the inhibitor.
16963045 2006 Correlation between first-trimester uterine artery Doppler indices and maternal serum free beta-human chorionic gonadotropin and pregnancy-associated plasma protein A.
16959807 2006 Correlation between first trimester fetal bone length and maternal serum pregnancy-associated plasma protein-A (PAPP-A).
16388849 2006 Modulation of PAPP-A expression by PPARgamma in human first trimester trophoblast.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16115888 2005 Pregnancy-associated plasma protein-A regulates myoblast proliferation and differentiation through an insulin-like growth factor-dependent mechanism.
16086443 2005 Prediction of pregnancy complications by first-trimester maternal serum PAPP-A and free beta-hCG and with second-trimester uterine artery Doppler.
15919757 2005 Pregnancy-associated plasma protein-a is involved in matrix mineralization of human adult mesenchymal stem cells and angiogenesis in the chick chorioallontoic membrane.
15754336 2005 Pregnancy-associated plasma protein-A proteolytic activity in rat vertebral cell cultures: stimulation by dexamethasone--a potential mechanism for glucocorticoid regulation of osteoprogenitor proliferation and differentiation.
15656990 2005 Identification of two novel human genes, DIPLA1 and DIPAS, expressed in placenta tissue.
15647258 2005 Proteinase inhibition by proform of eosinophil major basic protein (pro-MBP) is a multistep process of intra- and intermolecular disulfide rearrangements.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15450385 Differential display RT-PCR analysis of human choriocarcinoma cell lines and normal term trophoblast cells: identification of new genes expressed in placenta.
15305104 Low pregnancy-associated plasma protein-a at 10(+1) to 14(+6) weeks of gestation and a possible mechanism leading to miscarriage.
15262980 2004 The Lin12-notch repeats of pregnancy-associated plasma protein-A bind calcium and determine its proteolytic specificity.
15164053 2004 DNA sequence and analysis of human chromosome 9.
15146551 2004 Pregnancy-associated plasma protein-A (PAPP-A) expression and insulin-like growth factor binding protein-4 protease activity in normal and malignant ovarian surface epithelial cells.
14988014 2004 Inhibition of proteolysis by the proform of eosinophil major basic protein (proMBP) requires covalent binding to its target proteinase.
14705967 2004 Studies on regulation of IGF (insulin-like growth factor)-binding protein (IGFBP) 4 proteolysis by pregnancy-associated plasma protein-A (PAPP-A) in cells treated with phorbol ester.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14657012 2004 Pregnancy-associated plasma protein a gene expression as a target of inflammatory cytokines.
14530192 2003 Circulating pregnancy-associated plasma protein a predicts outcome in patients with acute coronary syndrome but no troponin I elevation.
12970325 2003 Localization and regulation of pregnancy-associated plasma protein a expression in healing human skin.
12817760 2003 Transforming growth factor-beta regulation of the insulin-like growth factor binding protein-4 protease system in cultured human osteoblasts.
12744930 2003 Expression of pregnancy-associated plasma protein-A (PAPP-A) during human villous trophoblast differentiation in vitro.
12687209 2001 Pregnancy-Associated Plasma Protein-A, Alpha-2-Macroglobulin, Pregnancy Zone Protein and Their Complexes with IgG in Sera of Healthy Non-Pregnant and Pregnant Woman, and Patients with Breast Cancer.
12626203 2002 Release patterns of pregnancy associated plasma protein A (PAPP-A) in patients with acute coronary syndromes.
12524241 2003 Serum plasma pregnancy-associated protein A: a potential marker of echogenic carotid atherosclerotic plaques in asymptomatic hyperlipidemic subjects at high cardiovascular risk.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421832 2003 Complex of pregnancy-associated plasma protein-A and the proform of eosinophil major basic protein. Disulfide structure and carbohydrate attachment.
12414897 2002 Pregnancy-associated plasma protein A proteolytic activity is associated with the human placental trophoblast cell membrane.
12370176 2002 Cell surface targeting of pregnancy-associated plasma protein A proteolytic activity. Reversible adhesion is mediated by two neighboring short consensus repeats.
12241545 2002 Substrate specificity of the metalloproteinase pregnancy-associated plasma protein-A (PAPP-A) assessed by mutagenesis and analysis of synthetic peptides: substrate residues distant from the scissile bond are critical for proteolysis.
12213189 2002 Differential regulation of pregnancy associated plasma protein (PAPP)-A during pregnancy in human and mouse.
11914564 Second-trimester maternal pregnancy-associated plasma protein a and inhibin a levels in fetal trisomies.
11822024 2002 Limb-girdle muscular dystrophy type 2H associated with mutation in TRIM32, a putative E3-ubiquitin-ligase gene.
11522292 2001 Pregnancy-associated plasma protein-A (PAPP-A) cleaves insulin-like growth factor binding protein (IGFBP)-5 independent of IGF: implications for the mechanism of IGFBP-4 proteolysis by PAPP-A.
11513734 2001 Mutational analysis of the proteolytic domain of pregnancy-associated plasma protein-A (PAPP-A): classification as a metzincin.
11134163 2000 Pregnancy-associated plasma protein-A gene expression in human ovaries is restricted to healthy follicles and corpora lutea.
10913121 2000 Expression of recombinant human pregnancy-associated plasma protein-A and identification of the proform of eosinophil major basic protein as its physiological inhibitor.
10491647 1999 Messenger ribonucleic acid levels of pregnancy-associated plasma protein-A and the proform of eosinophil major basic protein: expression in human reproductive and nonreproductive tissues.
10077652 1999 The insulin-like growth factor (IGF)-dependent IGF binding protein-4 protease secreted by human fibroblasts is pregnancy-associated plasma protein-A.
8620868 1996 Complete cDNA sequence of the preproform of human pregnancy-associated plasma protein-A. Evidence for expression in the brain and induction by cAMP.
7685339 1993 Circulating human pregnancy-associated plasma protein-A is disulfide-bridged to the proform of eosinophil major basic protein.
7679961 1993 Assignment of the human gene for pregnancy-associated plasma protein A (PAPPA) to 9q33.1 by fluorescence in situ hybridization to mitotic and meiotic chromosomes.
7586586 1995 Interaction of human pregnancy-associated plasma protein-A with serine proteinases.
7539791 1995 Identification of angiotensinogen and complement C3dg as novel proteins binding the proform of eosinophil major basic protein in human pregnancy serum and plasma.
7526035 1994 Localization of pregnancy-associated plasma protein-A and colocalization of pregnancy-associated plasma protein-A messenger ribonucleic acid and eosinophil granule major basic protein messenger ribonucleic acid in placenta.
7512304 1994 Regulation of insulin-like growth factor binding protein 4 by a specific insulin-like growth factor binding protein 4 proteinase in normal human osteoblast-like cells: implications in bone cell physiology.
7508748 1994 Amino acid sequence of human pregnancy-associated plasma protein-A derived from cloned cDNA.
6207082 1984 Histochemical localization of pregnancy-associated plasma protein A in fetal, infant, and adult organs and comparison between antisera.
6203109 Pregnancy-associated plasma protein A (PAPP-A) specifically inhibits the third component of human complement (C3).
6172371 1981 Immunological studies of the human placenta: functional and morphological analysis of pregnancy-associated plasma protein A (PAPP-A).
6084247 Immunohistochemical demonstration of pregnancy-associated plasma protein A (PAPP-A) in the syncytiotrophoblast of the normal placenta at different gestational ages.
2438405 1987 Potential role of pregnancy-associated plasma protein-A in human reproduction.
2427179 1986 Measurement of the pregnancy-associated proteins, placental protein 14 and pregnancy-associated plasma protein A in human seminal plasma.
2422961 1986 In vitro release of pregnancy-associated plasma protein-A (PAPP-A) by human endometrial cells.
1721035 1991 Pregnancy-associated plasma protein A interaction with heparin: a critical appraisal.