Property Summary

NCBI Gene PubMed Count 23
PubMed Score 5.75
PubTator Score 38.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.449 1.5e-02
Multiple myeloma 1.311 6.6e-03
malignant mesothelioma 1.100 1.8e-05
psoriasis 1.200 2.2e-04
osteosarcoma 1.529 7.2e-03
ependymoma 1.400 1.4e-07
group 3 medulloblastoma 1.800 2.4e-03
glioblastoma -1.600 2.8e-03
medulloblastoma, large-cell -1.900 2.3e-04
primitive neuroectodermal tumor 1.100 7.7e-04
juvenile dermatomyositis 1.073 1.1e-09
acute quadriplegic myopathy 1.188 1.6e-03
non-small cell lung cancer -1.066 1.2e-13
lung cancer 1.100 1.4e-03
pediatric high grade glioma -1.100 1.7e-02
atypical teratoid/rhabdoid tumor 1.200 4.4e-04
primary Sjogren syndrome 1.100 8.0e-04
aldosterone-producing adenoma -1.688 2.2e-02
lung adenocarcinoma 1.234 1.7e-04
spina bifida -1.204 3.9e-02
Breast cancer -1.500 7.8e-13
ovarian cancer 2.900 5.7e-05
Gaucher disease type 1 -1.200 1.5e-02
chronic rhinosinusitis -1.078 1.2e-02
cystic fibrosis and chronic rhinosinusit... -1.169 1.8e-02
dermatomyositis 1.800 1.2e-03

Gene RIF (5)

PMID Text
26496945 Lack of CstF-64 binding excludes PAPalpha from Star-PAP target pre-mRNA UTRs.CstF-64 and 3'-UTR cis-element determine Star-PAP specificity for target mRNA selection by excluding poly A polymerase.
25896913 The ability of PABPN1 to promote splicing requires its RNA binding and, to a lesser extent, poly(A)polymerase (PAP) - stimulatory functions.
20174964 Observations imply that translational regulation is among the conserved mechanisms regulating PAPOLA expression.
11878934 HIV-1 Vpr dephosphorylates poly(A) polymerase (PAP), presumably through inhibition of the p34cdc2/cyclin B kinase complex, leading to enhanced PAP activity
8491200 HIV-1 Vpr dephosphorylates poly(A) polymerase (PAP), presumably through inhibition of the p34cdc2/cyclin B kinase complex, leading to enhanced PAP activity

AA Sequence

MPFPVTTQGSQQTQPPQKHYGITSPISLAAPKETDCVLTQKLIETLKPFGVFEEEEELQRRILILGKLNN      1 - 70
LVKEWIREISESKNLPQSVIENVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVDRSDFFTSFYDKLKLQ     71 - 140
EEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIPEDLDLRDDSLLKNLDIRCIRSLNGCRVTDEI    141 - 210
LHLVPNIDNFRLTLRAIKLWAKRHNIYSNILGFLGGVSWAMLVARTCQLYPNAIASTLVHKFFLVFSKWE    211 - 280
WPNPVLLKQPEECNLNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSVSTRMVMVEEFKQGLAITDE    281 - 350
ILLSKAEWSKLFEAPNFFQKYKHYIVLLASAPTEKQRLEWVGLVESKIRILVGSLEKNEFITLAHVNPQS    351 - 420
FPAPKENPDKEEFRTMWVIGLVFKKTENSENLSVDLTYDIQSFTDTVYRQAINSKMFEVDMKIAAMHVKR    421 - 490
KQLHQLLPNHVLQKKKKHSTEGVKLTALNDSSLDLSMDSDNSMSVPSPTSATKTSPLNSSGSSQGRNSPA    491 - 560
PAVTAASVTNIQATEVSVPQVNSSESSGGTSSESIPQTATQPAISPPPKPTVSRVVSSTRLVNPPPRSSG    561 - 630
NAATSGNAATKIPTPIVGVKRTSSPHKEESPKKTKTEEDETSEDANCLALSGHDKTEAKEQLDTETSTTQ    631 - 700
SETIQTAASLLASQKTSSTDLSDIPALPANPIPVIKNSIKLRLNR                             701 - 745
//

Text Mined References (30)

PMID Year Title
26496945 2016 CstF-64 and 3'-UTR cis-element determine Star-PAP specificity for target mRNA selection by excluding PAP?.
25896913 2015 Poly(A) Polymerase and the Nuclear Poly(A) Binding Protein, PABPN1, Coordinate the Splicing and Degradation of a Subset of Human Pre-mRNAs.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20174964 2010 The structure of the 5'-untranslated region of mammalian poly(A) polymerase-alpha mRNA suggests a mechanism of translational regulation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19224921 2009 Inositol 1,4,5-triphosphate receptor-binding protein released with inositol 1,4,5-triphosphate (IRBIT) associates with components of the mRNA 3' processing machinery in a phosphorylation-dependent manner and inhibits polyadenylation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15169763 2004 Distinct sequence motifs within the 68-kDa subunit of cleavage factor Im mediate RNA binding, protein-protein interactions, and subcellular localization.
14749727 2004 Human Fip1 is a subunit of CPSF that binds to U-rich RNA elements and stimulates poly(A) polymerase.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14517258 2003 Regulation of poly(A) polymerase by 14-3-3epsilon.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
11878934 2002 Hypophosphorylation of poly(A) polymerase and increased polyadenylation activity are associated with human immunodeficiency virus type 1 Vpr expression.
10742179 2000 The NMR structure of the 38 kDa U1A protein - PIE RNA complex reveals the basis of cooperativity in regulation of polyadenylation by human U1A protein.
10429366 1999 Assignment of the human poly(A) polymerase (PAP) gene to chromosome 14q32.1-q32.2 and isolation of a polymorphic CA repeat sequence.
9356495 1997 Binding of factor VIIa to tissue factor induces alterations in gene expression in human fibroblast cells: up-regulation of poly(A) polymerase.
8491200 1993 Tat-dependent occlusion of the HIV poly(A) site.
8302877 1994 Multiple forms of poly(A) polymerases in human cells.
7590244 1995 The 160-kD subunit of human cleavage-polyadenylation specificity factor coordinates pre-mRNA 3'-end formation.