Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.45
PubTator Score 5.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
Rheumatoid Arthritis 1.200 1.8e-02
osteosarcoma 1.021 3.6e-03
ependymoma -1.200 1.5e-08
glioblastoma -1.400 8.8e-07
medulloblastoma, large-cell -1.200 1.4e-03
adrenocortical carcinoma 1.288 9.4e-06
adult high grade glioma -1.400 4.3e-05
pilocytic astrocytoma -1.100 1.7e-05

Gene RIF (3)

PMID Text
25049417 PAPD5 and PARN mediate degradation of oncogenic miRNA miR-21.
21788334 PAPD5 catalyzes the polyadenylation of different types of RNA substrates in vitro.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MYRSGERLLGSHALPAEQRDFLPLETTNNNNNHHQPGAWARRAGSSASSPPSASSSPHPSAAVPAADPAD      1 - 70
SASGSSNKRKRDNKASGGRAAGGGRADGGGVVYSGTPWKRRNYNQGVVGLHEEISDFYEYMSPRPEEEKM     71 - 140
RMEVVNRIESVIKELWPSADVQIFGSFKTGLYLPTSDIDLVVFGKWENLPLWTLEEALRKHKVADEDSVK    141 - 210
VLDKATVPIIKLTDSFTEVKVDISFNVQNGVRAADLIKDFTKKYPVLPYLVLVLKQFLLQRDLNEVFTGG    211 - 280
IGSYSLFLMAVSFLQLHPREDACIPNTNYGVLLIEFFELYGRHFNYLKTGIRIKDGGSYVAKDEVQKNML    281 - 350
DGYRPSMLYIEDPLQPGNDVGRSSYGAMQVKQAFDYAYVVLSHAVSPIAKYYPNNETESILGRIIRVTDE    351 - 420
VATYRDWISKQWGLKNRPEPSCNGPVSSSSATQSSSSDVDSDATPCKTPKQLLCRPSTGNRVGSQDVSLE    421 - 490
SSQAVGKMQSTQTTNTSNSTNKSQHGSARLFRSSSKGFQGTTQTSHGSLMTNKQHQGKSNNQYYHGKKRK    491 - 560
HKRDAPLSDLCR                                                              561 - 572
//

Text Mined References (16)

PMID Year Title
25049417 2014 PAPD5-mediated 3' adenylation and subsequent degradation of miR-21 is disrupted in proliferative disease.
23376078 2013 Molecular cloning and characterization of a novel isoform of the non-canonical poly(A) polymerase PAPD7.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22817747 2012 Comparison of the yeast and human nuclear exosome complexes.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21788334 2011 PAPD5, a noncanonical poly(A) polymerase with an unusual RNA-binding motif.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18172165 2008 Degradation of histone mRNA requires oligouridylation followed by decapping and simultaneous degradation of the mRNA both 5' to 3' and 3' to 5'.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10066793 1999 The topoisomerase-related function gene TRF4 affects cellular sensitivity to the antitumor agent camptothecin.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.