Property Summary

NCBI Gene PubMed Count 21
PubMed Score 56.09
PubTator Score 27.97

Knowledge Summary

Patent (3,286)

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.700 1.1e-07
Astrocytoma, Pilocytic -2.300 1.4e-12
atypical teratoid / rhabdoid tumor -2.600 5.9e-11
ependymoma -1.300 2.1e-02
glioblastoma -2.200 4.8e-11
group 3 medulloblastoma -1.600 5.6e-04
medulloblastoma, large-cell -2.800 4.5e-08
Multiple Sclerosis 1.100 2.3e-02
osteosarcoma 1.123 1.1e-04
primitive neuroectodermal tumor -1.400 8.9e-04
subependymal giant cell astrocytoma -1.858 1.1e-02

Gene RIF (11)

AA Sequence

MHHLLEQSADMATALLAGEKLRELILPGAQDDKAGALAALLLQLKLELPFDRVVTIGTVLVPILLVTLVF      1 - 70
TKNFAEEPIYCYTPHNFTRDQALYARGYCWTELRDALPGVDASLWPSLFEHKFLPYALLAFAAIMYVPAL     71 - 140
GWEFLASTRLTSELNFLLQEIDNCYHRAAEGRAPKIEKQIQSKGPGITEREKREIIENAEKEKSPEQNLF    141 - 210
EKYLERRGRSNFLAKLYLARHVLILLLSAVPISYLCTYYATQKQNEFTCALGASPDGAAGAGPAVRVSCK    211 - 280
LPSVQLQRIIAGVDIVLLCVMNLIILVNLIHLFIFRKSNFIFDKLHKVGIKTRRQWRRSQFCDINILAMF    281 - 350
CNENRDHIKSLNRLDFITNESDLMYDNVVRQLLAALAQSNHDATPTVRDSGVQTVDPSANPAEPDGAAEP    351 - 420
PVVKRPRKKMKWIPTSNPLPQPFKEPLAIMRVENSKAEKPKPARRKTATDTLIAPLLDRSAHHYKGGGGD    421 - 490
PGPGPAPAPAPPPAPDKKHARHFSLDVHPYILGTKKAKAEAVPAALPASRSQEGGFLSQAEDCGLGLAPA    491 - 560
PIKDAPLPEKEIPYPTEPARAGLPSGGPFHVRSPPAAPAVAPLTPASLGKAEPLTILSRNATHPLLHINT    561 - 630
LYEAREEEDGGPRLPQDVGDLIAIPAPQQILIATFDEPRTVVSTVEF                           631 - 677
//

Text Mined References (22)

PMID Year Title