Property Summary

NCBI Gene PubMed Count 72
PubMed Score 418.48
PubTator Score 200.32

Knowledge Summary

Patent (5,254)

Expression

  Differential Expression (10)

Disease log2 FC p
aldosterone-producing adenoma -1.022 9.0e-03
cutaneous lupus erythematosus 1.200 5.8e-03
diabetes mellitus -1.500 1.3e-03
group 3 medulloblastoma 1.200 9.0e-03
invasive ductal carcinoma 1.400 1.9e-03
juvenile dermatomyositis 1.530 3.0e-08
lung cancer 1.400 2.6e-04
ovarian cancer 1.700 1.6e-04
psoriasis 1.100 4.3e-05
ulcerative colitis 1.600 1.4e-07

 CSPA Cell Line (3)

Gene RIF (66)

AA Sequence

MAIAQLATEYVFSDFLLKEPTEPKFKGLRLELAVDKMVTCIAVGLPLLLISLAFAQEISIGTQISCFSPS      1 - 70
SFSWRQAAFVDSYCWAAVQQKNSLQSESGNLPLWLHKFFPYILLLFAILLYLPPLFWRFAAAPHICSDLK     71 - 140
FIMEELDKVYNRAIKAAKSARDLDMRDGACSVPGVTENLGQSLWEVSESHFKYPIVEQYLKTKKNSNNLI    141 - 210
IKYISCRLLTLIIILLACIYLGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVIN    211 - 280
LVVYVLLAPVVVYTLFVPFRQKTDVLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISEVKSYKCLKV    281 - 350
LENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQR    351 - 420
LLDSSC                                                                    421 - 426
//

Text Mined References (74)

PMID Year Title