Property Summary

Ligand Count 1
NCBI Gene PubMed Count 11
PubMed Score 10.34
PubTator Score 2.82

Knowledge Summary

Patent (664)

Expression

  Differential Expression (8)

Disease log2 FC p
acute quadriplegic myopathy 1.255 2.2e-05
dermatomyositis 1.200 1.1e-03
hereditary spastic paraplegia -1.221 3.1e-03
intraductal papillary-mucinous neoplasm ... 1.400 8.5e-03
lung cancer 1.100 1.4e-02
Multiple myeloma 1.144 8.4e-03
psoriasis 1.100 1.2e-03
ulcerative colitis -1.255 2.4e-04

 MGI Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (3)

AA Sequence

MKIKDAKKPSFPWFGMDIGGTLVKLSYFEPIDITAEEEQEEVESLKSIRKYLTSNVAYGSTGIRDVHLEL      1 - 70
KDLTLFGRRGNLHFIRFPTQDLPTFIQMGRDKNFSTLQTVLCATGGGAYKFEKDFRTIGNLHLHKLDELD     71 - 140
CLVKGLLYIDSVSFNGQAECYYFANASEPERCQKMPFNLDDPYPLLVVNIGSGVSILAVHSKDNYKRVTG    141 - 210
TSLGGGTFLGLCSLLTGCESFEEALEMASKGDSTQADKLVRDIYGGDYERFGLPGWAVASSFGNMIYKEK    211 - 280
RESVSKEDLARATLVTITNNIGSVARMCAVNEKINRVVFVGNFLRVNTLSMKLLAYALDYWSKGQLKALF    281 - 350
LEHEGYFGAVGALLGLPNFS                                                      351 - 370
//

Text Mined References (11)

PMID Year Title