Property Summary

NCBI Gene PubMed Count 64
PubMed Score 177.66
PubTator Score 238.39

Knowledge Summary

Patent (9,884)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0

Expression

  Differential Expression (7)

Disease log2 FC p
dermatomyositis 1.400 7.8e-04
group 4 medulloblastoma -1.200 1.2e-04
lung cancer 1.100 4.7e-03
medulloblastoma, large-cell -1.500 1.2e-05
osteosarcoma -1.612 1.7e-06
ovarian cancer -1.300 7.9e-05
Waldenstrons macroglobulinemia 1.161 1.4e-02

Protein-protein Interaction (3)

Gene RIF (50)

AA Sequence

MRRLGPFHPRVHWAAPPSLSSGLHRLLFLRGTRIPSSTTLSPPRHDSLSLDGGTVNPPRVREPTGREAFG      1 - 70
PSPASSDWLPARWRNGRGGRPRARLCSGWTAAEEARRNPTLGGLLGRQRLLLRMGGGRLGAPMERHGRAS     71 - 140
ATSVSSAGEQAAGDPEGRRQEPLRRRASSASVPAVGASAEGTRRDRLGSYSGPTSVSRQRVESLRKKRPL    141 - 210
FPWFGLDIGGTLVKLVYFEPKDITAEEEEEEVESLKSIRKYLTSNVAYGSTGIRDVHLELKDLTLCGRKG    211 - 280
NLHFIRFPTHDMPAFIQMGRDKNFSSLHTVFCATGGGAYKFEQDFLTIGDLQLCKLDELDCLIKGILYID    281 - 350
SVGFNGRSQCYYFENPADSEKCQKLPFDLKNPYPLLLVNIGSGVSILAVYSKDNYKRVTGTSLGGGTFFG    351 - 420
LCCLLTGCTTFEEALEMASRGDSTKVDKLVRDIYGGDYERFGLPGWAVASSFGNMMSKEKREAVSKEDLA    421 - 490
RATLITITNNIGSIARMCALNENINQVVFVGNFLRINTIAMRLLAYALDYWSKGQLKALFSEHEGYFGAV    491 - 560
GALLELLKIP                                                                561 - 570
//

Text Mined References (73)

PMID Year Title