Property Summary

NCBI Gene PubMed Count 16
PubMed Score 69.18
PubTator Score 13.27

Knowledge Summary

Patent (6,202)

Expression

 GWAS Trait (1)

Gene RIF (11)

PMID Text
25505242 The interaction of HIV-1 CA with human cellular pantothenate kinase 1 protein (PANK1) is identified by yeast two-hybrid screen
23343762 p53 plays an important role in regulating energy homeostasis through transcriptional control of PANK1.
22912811 PANK deficiency leads to abnormalities in F-actin organization.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19060910 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18187620 Knockdown of pantothenate kinase 1 (PANK1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17631502 analysis of the homodimeric structures of the catalytic cores of PanK1alpha and PanK3 in complex with acetyl-CoA and the the structural effects of the PanK2 mutations that have been implicated in neurodegeneration
16385451 Observational study of gene-disease association. (HuGE Navigator)
14523052 PPARalpha transcription factor as a major factor governing hepatic CoA levels by specific modulation of PANK1alpha gene expression
12379284 alternative splicing product
11809413 molecular cloning and characterization of a new human PanK gene

AA Sequence

MLKLVGGGGGQDWACSVAGTSLGGEEAAFEVARPGDQGKAGGGSPGWGCAGIPDSAPGAGVLQAGAVGPA      1 - 70
RGGQGAEEVGESAGGGEERRVRHPQAPALRLLNRKPQGGSGEIKTPENDLQRGRLSRGPRTAPPAPGMGD     71 - 140
RSGQQERSVPHSPGAPVGTSAAAVNGLLHNGFHPPPVQPPHVCSRGPVGGSDAAPQRLPLLPELQPQPLL    141 - 210
PQHDSPAKKCRLRRRMDSGRKNRPPFPWFGMDIGGTLVKLVYFEPKDITAEEEQEEVENLKSIRKYLTSN    211 - 280
TAYGKTGIRDVHLELKNLTMCGRKGNLHFIRFPSCAMHRFIQMGSEKNFSSLHTTLCATGGGAFKFEEDF    281 - 350
RMIADLQLHKLDELDCLIQGLLYVDSVGFNGKPECYYFENPTNPELCQKKPYCLDNPYPMLLVNMGSGVS    351 - 420
ILAVYSKDNYKRVTGTSLGGGTFLGLCCLLTGCETFEEALEMAAKGDSTNVDKLVKDIYGGDYERFGLQG    421 - 490
SAVASSFGNMMSKEKRDSISKEDLARATLVTITNNIGSIARMCALNENIDRVVFVGNFLRINMVSMKLLA    491 - 560
YAMDFWSKGQLKALFLEHEGYFGAVGALLELFKMTDDK                                    561 - 598
//

Text Mined References (17)

PMID Year Title
23343762 2013 p53-Dependent regulation of metabolic function through transcriptional activation of pantothenate kinase-1 gene.
22912811 2012 Cofilin/Twinstar phosphorylation levels increase in response to impaired coenzyme a metabolism.
20833636 2011 p53 activates the PANK1/miRNA-107 gene leading to downregulation of CDK6 and p130 cell cycle proteins.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19060910 2009 Genome-wide association analysis of metabolic traits in a birth cohort from a founder population.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17631502 2007 Crystal structures of human pantothenate kinases. Insights into allosteric regulation and mutations linked to a neurodegeneration disorder.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14523052 2004 PPARalpha controls the intracellular coenzyme A concentration via regulation of PANK1alpha gene expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12379284 2002 In reference to the Short Communication published by Ni et al.
11809413 2002 Cloning and characterization of a novel human pantothenate kinase gene.
11479594 2001 A novel pantothenate kinase gene (PANK2) is defective in Hallervorden-Spatz syndrome.
2981478 1985 Coenzyme A metabolism.