Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.22
PubTator Score 8.70

Knowledge Summary

Patent (1,945)

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma 1.500 3.9e-02
osteosarcoma -1.168 9.7e-04
juvenile dermatomyositis 1.574 1.1e-12
acute quadriplegic myopathy 1.295 7.2e-06
primary pancreatic ductal adenocarcinoma 1.221 3.7e-03
ovarian cancer -1.400 3.9e-05
pancreatic cancer 1.200 3.0e-03

Gene RIF (2)

PMID Text
25446091 arsenite-induced oxidative stress inhibits deadenylation of mRNA primarily through downregulation of Tob and Pan3, both of which mediate the recruitment of deadenylases to mRNA
14583602 hPan2 and hPan3 have roles in mRNA decay and exhibit cytoplasmic co-localization

AA Sequence

MNSGGGLPPPSAAASPSSSSLAAAVAVVAPPGVGGVPGGAAVGVKLKYCRYYAKDKTCFYGEECQFLHED      1 - 70
PAAGAAPGLGLHSNSVPLALAGAPVAGFPPGAVAGGGAGPPPGPKKPDLGDPGTGAAAGGGGSSGGLDGP     71 - 140
RLAIPGMDGGALTDTSLTDSYFSTSFIGVNGFGSPVETKYPLMQRMTNSSSSPSLLNDSAKPYSAHDPLT    141 - 210
SPASSLFNDFGALNISQRRKPRKYRLGMLEERLVPMGSKARKAKNPIGCLADRCKSGVPINMVWWNRVTE    211 - 280
NNLQTPNPTASEFIPKGGSTSRLSNVSQSNMSAFSQVFSHPSMGSPATAGLAPGMSLSAGSSPLHSPKIT    281 - 350
PHTSPAPRRRSHTPNPASYMVPSSASTSVNNPVSQTPSSGQVIQKETVGGTTYFYTDTTPAPLTGMVFPN    351 - 420
YHIYPPTAPHVAYMQPKANAPSFFMADELRQELINRHLITMAQIDQADMPAVPTEVDSYHSLFPLEPLPP    421 - 490
PNRIQKSSNFGYITSCYKAVNSKDDLPYCLRRIHGFRLVNTKCMVLVDMWKKIQHSNIVTLREVFTTKAF    491 - 560
AEPSLVFAYDFHAGGETMMSRHFNDPNADAYFTKRKWGQHEGPLPRQHAGLLPESLIWAYIVQLSSALRT    561 - 630
IHTAGLACRVMDPTKILITGKTRLRVNCVGVFDVLTFDNSQNNNPLALMAQYQQADLISLGKVVLALACN    631 - 700
SLAGIQRENLQKAMELVTINYSSDLKNLILYLLTDQNRMRSVNDIMPMIGARFYTQLDAAQMRNDVIEED    701 - 770
LAKEVQNGRLFRLLAKLGTINERPEFQKDPTWSETGDRYLLKLFRDHLFHQVTEAGAPWIDLSHIISCLN    771 - 840
KLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAANGQL                           841 - 887
//

Text Mined References (19)

PMID Year Title
25446091 2014 Arsenite inhibits mRNA deadenylation through proteolytic degradation of Tob and Pan3.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
23932717 2013 Structure of the PAN3 pseudokinase reveals the basis for interactions with the PAN2 deadenylase and the GW182 proteins.
23340509 2013 Phosphorylation at intrinsically disordered regions of PAM2 motif-containing proteins modulates their interactions with PABPC1 and influences mRNA fate.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21981923 2011 GW182 proteins directly recruit cytoplasmic deadenylase complexes to miRNA targets.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18625844 2008 Deadenylation is prerequisite for P-body formation and mRNA decay in mammalian cells.
18056425 2007 Mechanism of mRNA deadenylation: evidence for a molecular interplay between translation termination factor eRF3 and mRNA deadenylases.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17595167 2007 Poly(A) nuclease interacts with the C-terminal domain of polyadenylate-binding protein domain from poly(A)-binding protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14583602 2004 Identification of a human cytoplasmic poly(A) nuclease complex stimulated by poly(A)-binding protein.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.