Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.46
PubTator Score 2.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
posterior fossa group A ependymoma 2.600 8.6e-12
esophageal adenocarcinoma -1.400 2.9e-02
medulloblastoma, large-cell 2.600 2.1e-02
acute quadriplegic myopathy 1.024 6.2e-05
Atopic dermatitis -1.200 5.6e-03
adrenocortical carcinoma -1.185 4.0e-02
non-small cell lung cancer -2.438 1.9e-23
intraductal papillary-mucinous adenoma (... -2.800 3.1e-05
intraductal papillary-mucinous carcinoma... -2.500 1.3e-03
intraductal papillary-mucinous neoplasm ... -3.400 6.1e-05
lung cancer -3.000 4.9e-05
breast carcinoma -1.800 1.0e-20
fibroadenoma -1.800 1.4e-02
Breast cancer -2.500 2.9e-02
interstitial cystitis 1.200 4.9e-04
lung adenocarcinoma -2.000 4.6e-18
group 3 medulloblastoma 1.500 5.3e-03
pilocytic astrocytoma 1.100 4.6e-04
aldosterone-producing adenoma -1.106 1.8e-02
nasopharyngeal carcinoma -1.200 7.8e-04
lung carcinoma -2.200 1.6e-14
ductal carcinoma in situ -2.500 1.4e-04
invasive ductal carcinoma -3.300 6.5e-04
ulcerative colitis 1.100 3.1e-03
ovarian cancer -1.900 6.8e-04

Gene RIF (3)

PMID Text
24810057 findings define palmdelphin as a target of serine-46-phosphorylated p53 that controls cell death in response to DNA damage.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19584346 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MEEAELVKGRLQAITDKRKIQEEISQKRLKIEEDKLKHQHLKKKALREKWLLDGISSGKEQEEMKKQNQQ      1 - 70
DQHQIQVLEQSILRLEKEIQDLEKAELQISTKEEAILKKLKSIERTTEDIIRSVKVEREERAEESIEDIY     71 - 140
ANIPDLPKSYIPSRLRKEINEEKEDDEQNRKALYAMEIKVEKDLKTGESTVLSSIPLPSDDFKGTGIKVY    141 - 210
DDGQKSVYAVSSNHSAAYNGTDGLAPVEVEELLRQASERNSKSPTEYHEPVYANPFYRPTTPQRETVTPG    211 - 280
PNFQERIKIKTNGLGIGVNESIHNMGNGLSEERGNNFNHISPIPPVPHPRSVIQQAEEKLHTPQKRLMTP    281 - 350
WEESNVMQDKDAPSPKPRLSPRETIFGKSEHQNSSPTCQEDEEDVRYNIVHSLPPDINDTEPVTMIFMGY    351 - 420
QQAEDSEEDKKFLTGYDGIIHAELVVIDDEEEEDEGEAEKPSYHPIAPHSQVYQPAKPTPLPRKRSEASP    421 - 490
HENTNHKSPHKNSISLKEQEESLGSPVHHSPFDAQTTGDGTEDPSLTALRMRMAKLGKKVI             491 - 551
//

Text Mined References (16)

PMID Year Title
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24810057 2014 Palmdelphin, a novel target of p53 with Ser46 phosphorylation, controls cell death in response to DNA damage.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19584346 2009 Genetic variants associated with cardiac structure and function: a meta-analysis and replication of genome-wide association data.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15851553 2005 The lacrimal gland transcriptome is an unusually rich source of rare and poorly characterized gene transcripts.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11707320 2001 PALML, a novel paralemmin-related gene mapping on human chromosome 1p21.
11478809 2001 The paralemmin protein family: identification of paralemmin-2, an isoform differentially spliced to AKAP2/AKAP-KL, and of palmdelphin, a more distant cytosolic relative.