Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.72
PubTator Score 4.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -2.500 4.2e-04
astrocytic glioma -2.600 2.4e-03
Astrocytoma, Pilocytic -3.000 2.4e-07
atypical teratoid / rhabdoid tumor -3.800 2.9e-07
cystic fibrosis -1.042 3.2e-03
ependymoma -2.300 6.0e-03
glioblastoma -2.000 1.3e-04
group 3 medulloblastoma -2.700 1.1e-02
medulloblastoma, large-cell -3.000 1.2e-03
oligodendroglioma -2.100 1.2e-02
osteosarcoma 1.717 6.6e-03
ovarian cancer -1.100 4.7e-06
primitive neuroectodermal tumor -2.000 3.1e-02

Gene RIF (4)

AA Sequence

MEMAEAELHKERLQAIAEKRKRQTEIEGKRQQLDEQILLLQHSKSKVLREKWLLQGIPAGTAEEEEARRR      1 - 70
QSEEDEFRVKQLEDNIQRLEQEIQTLESEESQISAKEQIILEKLKETEKSFKDFQKGFSSTDGAVYAMEI     71 - 140
NVEKDKQTGETKILSTSTIGPEGVHQKGVKVYDDGTKVVYEVRSGGTVVENGVHKLSTKDVEELIQKAGQ    141 - 210
SSLGGGHVSERTVIADGSLSHPKEHMLCKEAKLEMVHKSRKDHSSGNPGQQAQAPSAAGPEANLDQPVTM    211 - 280
IFMGYQNIEDEEETKKVLGYDETIKAELVLIDEDDEKSLREKTVTDVSTIDGNAAELVSGRPVSDTTEPS    281 - 350
SPEGKEESLATEPAPGTQKKKRCQCCVVM                                             351 - 379
//

Text Mined References (15)

PMID Year Title