Property Summary

NCBI Gene PubMed Count 38
PubMed Score 40.43
PubTator Score 28.56

Knowledge Summary

Patent (10,514)

TINX Plot

  Disease (2)

Expression

Protein-protein Interaction (3)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (20)

PMID Text
26459798 PAK6 is directly targeted by miR-328. miR-328 inhibits cell growth and promotes cell apoptosis in prostate cancer cells.
26442588 negative correlation between PAK6 and EZH2 expression was observed in hepatoma tissues from HCC patients. These data identified the tumor suppressive role and potential underlying mechanism of PAK6 in hepatocarcinogenesis
26375402 p21-activated kinase 6 (PAK6) as a novel interactor of leucine-rich repeat kinase 2 (LRRK2), a kinase involved in Parkinson's disease
26058485 the results of the present study suggested that miR-429 inhibits the migration and invasion of colon cancer cells, partly at least, by mediating the expression of PAK6, as well as the activity of cofilin signaling
25426562 we report that in colon cancer PAK6 promotes tumor progression and chemoresistance both in vitro and in vivo
24576777 PAK6 is overexpressed in hepatocellular carcinoma, compared with the adjacent noncancerous liver tissues, and is associated with poor prognosis.
24352566 PAK6 is specifically required for carcinoma cell-cell dissociation downstream of hepatocyte growth factor (HGF) for both DU145 prostate cancer and HT29 colon cancer cells.
24130878 These results demonstrate that androgen-stimulated PAK6 activation is mediated through a direct interaction between AR and PAK6 and PAK6 activation promotes prostate cancer cells motility and invasion.
23685956 PAK5 plays an essential role in the initiation and progression of hepatocellular carcinoma.
23132866 PAK6 phosphorylates Mdm2 on Thr-158 and Ser-186, which is critical for AR ubiquitin-mediated degradation.
20524398 Hypermethylation of PAK6 gene is associated with adenocarcinoma.
20453000 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18642328 PAK6 was weakly expressed in normal prostate epithelium. Its expression was increased in primary and metastatic prostate cancer, and was further increased in tumors that relapsed after androgen deprivation therapy.
18465753 PAK5 is a potent regulator of Raf-1 activity and may control Raf-1 dependent signaling at mitochondria
17584649 Results indicate that all of the 3 prostate cancer specimens showed positive staining in the stroma, suggesting that PAK6 may participate in the stroma-cancer cell interaction in prostate cancer.
15550393 The activation of PAK6 by both p38 MAP kinase and MKK6 suggests that PAK6 plays a role in the cellular response to stress-related signals.

AA Sequence

MFRKKKKKRPEISAPQNFQHRVHTSFDPKEGKFVGLPPQWQNILDTLRRPKPVVDPSRITRVQLQPMKTV      1 - 70
VRGSAMPVDGYISGLLNDIQKLSVISSNTLRGRSPTSRRRAQSLGLLGDEHWATDPDMYLQSPQSERTDP     71 - 140
HGLYLSCNGGTPAGHKQMPWPEPQSPRVLPNGLAAKAQSLGPAEFQGASQRCLQLGACLQSSPPGASPPT    141 - 210
GTNRHGMKAAKHGSEEARPQSCLVGSATGRPGGEGSPSPKTRESSLKRRLFRSMFLSTAATAPPSSSKPG    211 - 280
PPPQSKPNSSFRPPQKDNPPSLVAKAQSLPSDQPVGTFSPLTTSDTSSPQKSLRTAPATGQLPGRSSPAG    281 - 350
SPRTWHAQISTSNLYLPQDPTVAKGALAGEDTGVVTHEQFKAALRMVVDQGDPRLLLDSYVKIGEGSTGI    351 - 420
VCLAREKHSGRQVAVKMMDLRKQQRRELLFNEVVIMRDYQHFNVVEMYKSYLVGEELWVLMEFLQGGALT    421 - 490
DIVSQVRLNEEQIATVCEAVLQALAYLHAQGVIHRDIKSDSILLTLDGRVKLSDFGFCAQISKDVPKRKS    491 - 560
LVGTPYWMAPEVISRSLYATEVDIWSLGIMVIEMVDGEPPYFSDSPVQAMKRLRDSPPPKLKNSHKVSPV    561 - 630
LRDFLERMLVRDPQERATAQELLDHPFLLQTGLPECLVPLIQLYRKQTSTC                       631 - 681
//

Text Mined References (42)

PMID Year Title
26459798 2015 MicroRNA?328 directly targets p21?activated protein kinase 6 inhibiting prostate cancer proliferation and enhancing docetaxel sensitivity.
26442588 2015 Tumor Suppressive Function of p21-activated Kinase 6 in Hepatocellular Carcinoma.
26375402 2015 Leucine-rich repeat kinase 2 interacts with p21-activated kinase 6 to control neurite complexity in mammalian brain.
26058485 2015 MicroRNA-429 inhibits the migration and invasion of colon cancer cells by targeting PAK6/cofilin signaling.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25426562 2015 PAK6 increase chemoresistance and is a prognostic marker for stage II and III colon cancer patients undergoing 5-FU based chemotherapy.
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24947832 2014 Differential protein-protein interactions of LRRK1 and LRRK2 indicate roles in distinct cellular signaling pathways.
24576777 2014 Expression and prognostic significance of p21-activated kinase 6 in hepatocellular carcinoma.
24510904 2014 Unbiased screen for interactors of leucine-rich repeat kinase 2 supports a common pathway for sporadic and familial Parkinson disease.
24352566 2014 A PAK6-IQGAP1 complex promotes disassembly of cell-cell adhesions.
24130878 2013 Direct interaction between AR and PAK6 in androgen-stimulated PAK6 activation.
23685956 2014 P21-activated kinase 5 plays essential roles in the proliferation and tumorigenicity of human hepatocellular carcinoma.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23132866 2013 p21-Activated kinase 6 (PAK6) inhibits prostate cancer growth via phosphorylation of androgen receptor and tumorigenic E3 ligase murine double minute-2 (Mdm2).
22339630 2012 Pak6 protein kinase is a novel effector of an atypical Rho family GTPase Chp/RhoV.
20817787 2010 Group I p21-activated kinases regulate thyroid cancer cell migration and are overexpressed and activated in thyroid cancer invasion.
20524398 2010 Distinct DNA methylation profiles between adenocarcinoma and squamous cell carcinoma of human uterine cervix.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20070256 2010 The emerging importance of group II PAKs.
20054820 2010 Inhibition of p21-activated kinase 6 (PAK6) increases radiosensitivity of prostate cancer cells.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19362342 2009 Knockdown of p21-activated kinase 6 inhibits prostate cancer growth and enhances chemosensitivity to docetaxel.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18642328 2008 Increased PAK6 expression in prostate cancer and identification of PAK6 associated proteins.
18465753 2008 p21 activated kinase 5 activates Raf-1 and targets it to mitochondria.
17584649 2007 [Cloning of human PAK6 cDNA, preparation of anti-PAK6 polyclonal antibody and PAK6 expression in prostate cancer].
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15550393 2005 Activation of p21-activated kinase 6 by MAP kinase kinase 6 and p38 MAP kinase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14573606 2004 Mechanism of p21-activated kinase 6-mediated inhibition of androgen receptor signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11773441 2002 AR and ER interaction with a p21-activated kinase (PAK6).
11278661 2001 Androgen receptor specifically interacts with a novel p21-activated kinase, PAK6.