Property Summary

NCBI Gene PubMed Count 45
PubMed Score 36.14
PubTator Score 25.46

Knowledge Summary

Patent (9,430)

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -4.600 1.0e-05
astrocytic glioma -2.700 3.5e-03
Astrocytoma, Pilocytic -2.600 1.3e-04
atypical teratoid / rhabdoid tumor -4.700 1.1e-06
Breast cancer -3.100 3.4e-144
ependymoma -3.300 5.4e-03
glioblastoma -3.500 6.3e-06
group 4 medulloblastoma -1.200 2.0e-02
medulloblastoma, large-cell -4.500 3.3e-07
oligodendroglioma -1.900 1.3e-02
ovarian cancer -1.900 1.1e-07
pituitary cancer 1.900 3.8e-05
primitive neuroectodermal tumor -1.100 3.7e-02
psoriasis -1.800 1.9e-24
subependymal giant cell astrocytoma -3.943 1.3e-03

Gene RIF (24)

AA Sequence

MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCITPIQLAPMKTI      1 - 70
VRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHAEENGFITFSQYSSESDTTAD     71 - 140
YTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEAYYSEVKPLKSDFARFSADYHSHLDSLSKPS    141 - 210
EYSDLKWEYQRASSSSPLDYSFQFTPSRTAGTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQP    211 - 280
TMRQRSRSGSGLQEPMMPFGASAFKTHPQGHSYNSYTYPRLSEPTMCIPKVDYDRAQMVLSPPLSGSDTY    281 - 350
PRGPAKLPQSQSKSGYSSSSHQYPSGYHKATLYHHPSLQSSSQYISTASYLSSLSLSSSTYPPPSWGSSS    351 - 420
DQQPSRVSHEQFRAALQLVVSPGDPREYLANFIKIGEGSTGIVCIATEKHTGKQVAVKKMDLRKQQRREL    421 - 490
LFNEVVIMRDYHHDNVVDMYSSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIATVCLSVLRALSYLH    491 - 560
NQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKRKSLVGTPYWMAPEVISRLPYGTEVDIWSLG    561 - 630
IMVIEMIDGEPPYFNEPPLQAMRRIRDSLPPRVKDLHKVSSVLRGFLDLMLVREPSQRATAQELLGHPFL    631 - 700
KLAGPPSCIVPLMRQYRHH                                                       701 - 719
//

Text Mined References (51)

PMID Year Title