Property Summary

NCBI Gene PubMed Count 56
PubMed Score 20.29
PubTator Score 44.86

Knowledge Summary

Patent (19,308)

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma -3.000 2.7e-03
ependymoma -3.400 1.4e-02
oligodendroglioma -2.000 1.9e-10
glioblastoma multiforme -3.300 5.2e-20
medulloblastoma -1.400 3.6e-02
cystic fibrosis 1.100 2.2e-03
atypical teratoid / rhabdoid tumor -4.400 7.4e-05
medulloblastoma, large-cell -4.600 5.4e-04
Atopic dermatitis -1.300 8.7e-05
primary pancreatic ductal adenocarcinoma -1.801 1.2e-04
intraductal papillary-mucinous adenoma (... -1.400 2.6e-02
intraductal papillary-mucinous carcinoma... -3.100 3.8e-06
intraductal papillary-mucinous neoplasm ... -2.900 5.4e-04
pancreatic cancer -2.200 3.3e-05
adult high grade glioma -2.400 4.9e-03
pilocytic astrocytoma -1.500 1.1e-03
lung carcinoma 3.900 1.1e-44
Breast cancer -4.100 1.9e-44
invasive ductal carcinoma -1.400 3.7e-04
ovarian cancer -1.300 1.0e-03
pituitary cancer 1.200 5.3e-06
psoriasis -1.300 2.2e-36

Protein-protein Interaction (8)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (13)

PMID Text
25981171 This study showed that PARK3 messenger RNA levels was significantly upregulated in subjects with schizophrenia in laminar and cellular samples.
25666757 This study identified predicted pathogenic, hemizygous variants on chromosome X in disease genes PAK3.
25596744 Data show that group I p21-activated kinases (Paks) Pak1 and Pak2 were much more abundant than Pak3 in meningioma.
25109462 Cdc42Hs binds to the effector domain of PAK3
23818969 Results show elevated PAK3 expression at both the mRNA and protein level in cJun/AP-1-over-expressing Rat1a fibroblasts, as well as in transformed human fibroblasts.
23622267 Group I p21-activated kinases augment Tax-mediated transcriptional activation of human T-cell leukemia virus type 1 long terminal repeats in a kinase-independent manner.
21949127 p21-Activated kinase 3 (PAK3) protein regulates synaptic transmission through its interaction with the Nck2/Grb4 protein adaptor.
20960100 potential role of PAK3 in the progression of ACTH-producing thymic carcinoid
18805672 Observational study of gene-disease association. (HuGE Navigator)
18523455 PAK3 mutations result in a specific form of X-linked mental retardation with fairly constant clinical features.
15574732 PAK3 is a key regulator of synapse formation and plasticity in the hippocampus. The MRX30 mutation might contribute to the cognitive deficits underlying this form of X-linked mental retardation.
15099969 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12464619 PAK3 codes for a splice variant that contains a 45-bp alternatively spliced exon. The exon encodes 15 aa that are inserted in the regulatory domain. PAK3b displays a high kinase activity in starved cells that is not further stimulated by active GTPases.

AA Sequence

MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEI      1 - 70
SLPSDFEHTIHVGFDAVTGEFTPDLYGSQMCPGKLPEGIPEQWARLLQTSNITKLEQKKNPQAVLDVLKF     71 - 140
YDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPPLAPPVSEEEDEEEEEEEDENEPPPVIAPRP    141 - 210
EHTKSIYTRSVVESIASPAVPNKEVTPPSAENANSSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPK    211 - 280
KKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVG    281 - 350
DELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTD    351 - 420
FGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIA    421 - 490
TNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPLSSLTPLIIAAKEAIKNSSR     491 - 559
//

Text Mined References (58)

PMID Year Title
25981171 2015 Altered expression of CDC42 signaling pathway components in cortical layer 3 pyramidal cells in schizophrenia.
25666757 2015 Whole-exome sequencing points to considerable genetic heterogeneity of cerebral palsy.
25596744 2015 Group I Paks as therapeutic targets in NF2-deficient meningioma.
25109462 2014 Dynamic and thermodynamic response of the Ras protein Cdc42Hs upon association with the effector domain of PAK3.
24184505 2014 A novel long non-coding RNA-ARA: adriamycin resistance-associated.
23818969 2013 p21-activated kinase 3 (PAK3) is an AP-1 regulated gene contributing to actin organisation and migration of transformed fibroblasts.
23622267 2013 Group I p21-activated kinases facilitate Tax-mediated transcriptional activation of the human T-cell leukemia virus type 1 long terminal repeats.
21949127 2011 p21-Activated kinase 3 (PAK3) protein regulates synaptic transmission through its interaction with the Nck2/Grb4 protein adaptor.
21177870 2011 Activation loop phosphorylation of ERK3/ERK4 by group I p21-activated kinases (PAKs) defines a novel PAK-ERK3/4-MAPK-activated protein kinase 5 signaling pathway.
21115725 2011 p21-Activated kinases 1 and 3 control brain size through coordinating neuronal complexity and synaptic properties.
20960100 2010 p21-activated kinase 3 is overexpressed in thymic neuroendocrine tumors (carcinoids) with ectopic ACTH syndrome and participates in cell migration.
20596523 2010 Development and validation of a method for profiling post-translational modification activities using protein microarrays.
19036346 2009 PAK signalling in neuronal physiology.
18805672 2008 Sequence analysis of P21-activated kinase 3 (PAK3) in chronic schizophrenia with cognitive impairment.
18639460 2008 UnPAKing the class differences among p21-activated kinases.
18523455 2008 A novel splice mutation in PAK3 gene underlying mental retardation with neuropsychiatric features.
18507705 2008 The four mammalian splice variants encoded by the p21-activated kinase 3 gene have different biological properties.
17853471 2007 PAK3 related mental disability: further characterization of the phenotype.
17452356 2007 Non-EST-based prediction of novel alternatively spliced cassette exons with cell signaling function in Caenorhabditis elegans and human.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15574732 2004 The mental retardation protein PAK3 contributes to synapse formation and plasticity in hippocampus.
15548136 2005 PAK and other Rho-associated kinases--effectors with surprisingly diverse mechanisms of regulation.
15099969 2004 p53 and p21 genetic polymorphisms and susceptibility to endometrial cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14673471 2004 A comparative expression analysis of four MRX genes regulating intracellular signalling via small GTPases.
12890786 2003 DNA synthesis and neuronal apoptosis caused by familial Alzheimer disease mutants of the amyloid precursor protein are mediated by the p21 activated kinase PAK3.
12884430 2003 X-linked mild non-syndromic mental retardation with neuropsychiatric problems and the missense mutation A365E in PAK3.
12777533 2003 Gene diversity patterns at 10 X-chromosomal loci in humans and chimpanzees.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12464619 2003 A new constitutively active brain PAK3 isoform displays modified specificities toward Rac and Cdc42 GTPases.
12237306 2002 Synapsin I is phosphorylated at Ser603 by p21-activated kinases (PAKs) in vitro and in PC12 cells stimulated with bradykinin.
11862216 2002 Integrins regulate GTP-Rac localized effector interactions through dissociation of Rho-GDI.
11741931 2002 Regulation of the Cool/Pix proteins: key binding partners of the Cdc42/Rac targets, the p21-activated kinases.
11517222 2001 Dual regulation of mammalian myosin VI motor function.
11278553 2001 NCK and PAK participate in the signaling pathway by which vascular endothelial growth factor stimulates the assembly of focal adhesions.
11278486 2001 The mechanism of PAK activation. Autophosphorylation events in both regulatory and kinase domains control activity.
11259591 2001 S338 phosphorylation of Raf-1 is independent of phosphatidylinositol 3-kinase and Pak3.
11096073 2001 Interaction of paxillin with p21-activated Kinase (PAK). Association of paxillin alpha with the kinase-inactive and the Cdc42-activated forms of PAK3.
10946356 2000 Missense mutation in PAK3, R67C, causes X-linked nonspecific mental retardation.
10896954 2000 The GIT family of ADP-ribosylation factor GTPase-activating proteins. Functional diversity of GIT2 through alternative splicing.
10461188 1999 Pak to the future.
10205168 1999 Serine and tyrosine phosphorylations cooperate in Raf-1, but not B-Raf activation.
10075701 1999 Multisite autophosphorylation of p21-activated protein kinase gamma-PAK as a function of activation.
9823899 1998 The protein kinase Pak3 positively regulates Raf-1 activity through phosphorylation of serine 338.
9731525 1998 PAK3 mutation in nonsyndromic X-linked mental retardation.
9726964 1998 A novel regulator of p21-activated kinases.
9722579 1998 Different molecular mechanisms for Rho family GTPase-dependent, Ca2+-independent contraction of smooth muscle.
9659915 1998 PAK kinases are directly coupled to the PIX family of nucleotide exchange factors.
9332663 1997 Gene for nonspecific X-linked mental retardation (MRX 47) is located in Xq22.3-q24.
9110174 1997 Large-scale concatenation cDNA sequencing.
9065412 1997 Identification of two essential phosphorylated threonine residues in the catalytic domain of Mekk1. Indirect activation by Pak3 and protein kinase C.
8826460 1996 Regional localisation of two non-specific X-linked mental retardation genes (MRX30 and MRX31).
8687195 1996 X-linked nonprogressive congenital cerebellar hypoplasia: clinical description and mapping to chromosome Xq.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8107774 1994 A brain serine/threonine protein kinase activated by Cdc42 and Rac1.
7559638 1995 Molecular cloning of a new member of the p21-Cdc42/Rac-activated kinase (PAK) family.