Property Summary

NCBI Gene PubMed Count 323
PubMed Score 228.63
PubTator Score 357.05

Knowledge Summary

Patent (25,992)

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma -3.400 4.5e-08
astrocytic glioma -3.400 8.1e-04
ependymoma -3.500 1.3e-03
oligodendroglioma -3.000 7.5e-03
glioblastoma -3.300 2.3e-07
osteosarcoma 1.312 1.9e-06
medulloblastoma -2.400 1.6e-08
cystic fibrosis 1.378 8.9e-05
atypical teratoid / rhabdoid tumor -2.500 6.4e-05
medulloblastoma, large-cell -2.800 3.6e-06
primitive neuroectodermal tumor -1.900 1.4e-03
tuberculosis 1.700 1.9e-06
non-small cell lung cancer 1.895 7.5e-18
intraductal papillary-mucinous adenoma (... 1.300 1.6e-02
intraductal papillary-mucinous carcinoma... 1.300 2.5e-02
intraductal papillary-mucinous neoplasm ... 1.900 1.1e-02
lung cancer 1.600 5.8e-05
pancreatic cancer 1.200 6.4e-06
pediatric high grade glioma -3.000 1.1e-08
pilocytic astrocytoma -2.600 4.9e-09
subependymal giant cell astrocytoma -2.099 1.2e-02
lung carcinoma 1.100 3.8e-19
Pick disease -1.800 2.1e-03
ovarian cancer -1.400 6.2e-06

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
2374 other 1 / 0 / 0 PAK-Effector Pull-down Assay for Quantification of Rac/Cdc42 Activation Using 3T3 Cells

Gene RIF (233)

PMID Text
27012601 Data show association of G protein-coupled receptor kinase-interacting protein 1 (GIT1), p21-activated kinase interacting exchange factor (betaPIX), and p21 protein (Cdc42/Rac)-activated kinase 1 (PAK1) with centrosomes.
27003261 PAK1 nuclear translocation is ligand-dependent: only PRL but not E2 stimulated PAK1 nuclear translocation
26809475 Formation of filopodia by membrane glycoprotein M6a (Gpm6a) requires actin regulator coronin-1a (Coro1a), known to regulate plasma membrane localization and activation of Rac1 and its downstream effector Pak1.
26774265 Combination of a PAK1 inhibitor such as FRAX597 with cytotoxic chemotherapy deserves further study as a novel therapeutic approach to pancreatic cancer treatment.
26547035 Data indicate that NOTCH1 receptor intracellular domain (NOTCH1-IC) physically interacts with serine-threonine-protein kinase PAK 1 (PAK1) in intact cells.
26379399 beta-elemene enhances radiosensitivity of gastric cancer cells by inhibiting Pak1 signaling.
26377044 These findings indicate that genetic variants in PAK1 gene may contribute to susceptibility to lung cancer in the Chinese population.
26255026 Cx43 increases serum induced filopodia formation via activation of p21-activated protein kinase 1.
26218748 Pak1 promote endometrial cancer cell proliferation.
26160174 There is a major role of the CK2alpha-interacting protein CKIP-1 in activation of PAK1 for neoplastic prostate cells transformation.
26104863 Pak1 is an important factor in the initiation and progression of atherogenesis.
26078008 Pak1 and Pak2 counteract centrosome separation in a kinase-dependent manner.
26036343 PAK1 overexpression and activation in inflammation and colitis-associated cancer promote NF-kappaB activity via suppression of PPARgamma in intestinal epithelial cells.
26023713 Study indicates that PAK1 is important in metastasis and progression of primary esophageal small cell carcinoma. The contribution of PAK1 to clinical outcomes may be involved in regulating DNA damage pathway.
26004135 Rich1 negatively regulates the epithelial cell cycle, proliferation and adhesion by CDC42/RAC1-PAK1-Erk1/2 pathway.
25981171 This study showed that PAK1 messenger RNA levels were significantly downregulated specifically in deep layer 3 pyramidal cells in patient with schizophrenia.
25956913 Studied the role of PAK1/Crk axis in transduction of the oncogenic KRAS signal in non-small cell lung cancer (NSCLC).
25888627 PAK1-mediated MORC2 phosphorylation promotes gastric tumorigenesis
25791829 PAK1 and PAK4 expression were associated with colorectal cancer metastasis and infiltration
25766321 these findings provide important evidence that PAK1 can positively regulate RUFY3 expression, which contribute to the metastatic potential of gastric cancer cells
25746720 TGFbeta1 induces apoptosis and epithelial-mesenchymal transition in prostate cancer cells via activation of P38-MAPK and Rac1/Pak1 respectively.
25675297 results unraveled that oncogenic activation of PAK1 defines an important mechanism for maintaining stem-like phenotype and sunitinib resistance through NF-kappaB/IL-6 activation in RCC.
25596744 Data show that group I p21-activated kinases (Paks) Pak1 and Pak2 were much more abundant than Pak3 in meningioma.
25569743 Overexpression of PAK1 promotes cell survival in inflammatory bowel diseases and colitis-associated cancer.
25472536 A pivotal role for PRL/PAK1 signaling in breast cancer metastasis.[review]
25466889 High Phosphorylation of tyrosine 285 of PAK1 protein is associated with breast cancer.
25456130 These results reveal a leukemic pathway involving FAK/Tiam1/Rac1/PAK1 and demonstrate an essential role for these signaling molecules in regulating the nuclear translocation of Stat5 in leukemogenesis.
25447917 miR-221-3p has an effect on PAK1 gene expressions in breast cancer cell lines
25416031 PAK1 role in cardiac physiology such as egulation of cardiac excitability and contractility has been identified.
25415869 Studies indicate a p21-activated kinase PAK1 inhibitor series were discovered.
25412958 we demonstrated that the overexpression of PAK1 is closely associated with the clinicopathological features of BC, suggesting that PAK1 may play an important role in the development and progression of Bladder cancer
25388666 Provide first evidence for existence of a previously unknown Erk5/KLF2/PAK1 axis, which may limit undesired cell migration in unperturbed endothelium and lower its sensitivity for migratory cues that promote vascular diseases including atherosclerosis.
25327287 Moreover, the up-regulation of Axl was induced by TGF-beta1, further activated phosphatidylinositol 3-kinase (PI3K)/Akt and PAK1 translocation, and resulted in greater cell motility, invasion, and chemoresistance in vitro and in vivo
25228413 Increased p21-activated kinase is associated with invasive papillary thyroid cancers.
25215948 PAK1 is an essential controller of inflammatory macrophage polarization, regulating immune responses against pathogenic stimuli.
25182632 PAK1 is a novel prognostic marker for pathologically confirmed human pancreatic cancer. Reduced expression of PAK1 correlates with poor histological differentiation in pancreatic cancer.
25159681 high PAK1 expression in PTs is predictive of node metastasis and can be easily integrated in the clinical decision process for personalized therapeutics of GEJA.
25125660 findings offered evidence that JAK2 phosphorylates and stabilizes functions of PAK1 that promote EMT and radioresistance in lung cancer cells
25074413 results provide evidence for a functional role of MET/PAK1 signalling in pancreatic adenocarcinoma
25019394 PAK1 and Snail1 are involved in the formation of estrogen-independent phenotype of breast cancer cells showing the potential role of both proteins as markers of hormone resistance of breast tumors.
24954107 Data indicate that p21-activated kinase 1 (PAK1) is a target of miR-145.
24935174 Amplified PAK1, as well as KRAS amplification/mutation, may represent unique opportunities for developing targeted therapeutics for the treatment of gastric cancer.
24859002 Describe here an invadopodia disassembly model, where a signalling axis involving TrioGEF, Rac1, Pak1, and phosphorylation of cortactin, causes invadopodia dissolution.
24811999 Review of the role of PAK1 in gastrointestinal inflammation and progression to cancer.
24634274 PAK1 is associated with the aggressive tumor behavior and poor prognosis of head and neck cancer.
24561527 identified fibronectin, a component of the extracellular matrix and a mesenchymal marker, as a transcriptional target of Pak1 signaling
24347489 blocking PI3K/Akt signaling pathway by LY294002 or Akt siRNA could remarkably inhibit the PAK1 activation and cell invasion
24236193 PAK1 is overexpressed during tumorigenic progression and its upregulation correlates with malignant properties mainly relevant to invasion and metastasis.
23986795 The Nef/hnRNPK/PKC-delta/Hck protein complex activates Pak2 activity but inhibits Pak1 activity, which induces paxillin phosphorylation on Ser272/274 and regulates paxillin/TACE association and secretion
23885116 These findings identify CK2 as an upstream activating kinase of PAK1, providing a novel mechanism for PAK1 activation.
23811795 The results identified Mgat5-mediated beta-1-6-GlcNAc branched N-glycosylation and following activation of EGFR as a potential novel upstream molecular event for PAK1-induced anoikis resistance in hepatoma cells.
23811286 PAK1 stimulates colorectal cancer cell survival by up-regulation of HIF-1alpha.
23746211 The Nef/hnRNPK/PKC-delta/Hck protein complex activates Pak2 activity but inhibits Pak1 activity, which induces paxillin phosphorylation on Ser272/274 and regulates paxillin/TACE association and secretion
23744893 These data illustrate the complex interaction between the substratum and PRL/PAK1 signaling in human breast cancer cells and suggest a pivotal role for PRL-dependent PAK1 tyrosyl phosphorylation in MMP secretion.
23737530 Data indicate that depletion of NFATc1, cyclin D1, CDK6, or CDK4 levels attenuated MCP1-induced Pak1 phosphorylation/activation and resulted in decreased aortic smooth muscle cells (HASMCs) F-actin stress fiber formation, migration, and proliferation.
23653349 PAK1 can stimulate MEK activity in a kinase-independent manner, probably by serving as a scaffold to facilitate interaction of C-RAF.
23622267 Group I p21-activated kinases augment Tax-mediated transcriptional activation of human T-cell leukemia virus type 1 long terminal repeats in a kinase-independent manner.
23613712 no significant change in PAK1 level detected in the schizophrenia subjects
23576562 Data indicate a signaling pathway from ErbB2 to p21-Activated kinase-1 (Pak1) to beta-catenin that is required for efficient transformation of mammary epithelial cells.
23559827 The Nef/hnRNPK/PKC-delta/Hck protein complex activates Pak2 activity but inhibits Pak1 activity, which induces paxillin phosphorylation on Ser272/274 and regulates paxillin/TACE association and secretion
23535073 Taken together, our results provide evidence for a functional role of PAK1 in BRAF wild-type melanoma and therapeutic use of PAK inhibitors in this indication.
23516476 Klotho endows hepatoma cells with resistance to anoikis via VEGFR2/PAK1 activation in hepatocellular carcinoma.
23499762 Cytokine-induced migration correlated with phosphorylation of PAK1 in primary myeloma cells & cell lines. Downregulation of PAK1 with siRNA in INA-6 cells resulted in decreased cytokine-driven migration.
23393142 analysis of synergistic activation of p21-activated kinase 1 by phosphatidylinositol 4,5-bisphosphate and Rho GTPases
23340249 PAK1 phosphorylates serine (Ser) 2152 of the actin-binding protein filamin A to a greater extent when PAK1 is tyrosyl phosphorylated by JAK2.
23338047 These results suggest that Pak1 plays important roles at multiple stages of EC progression.
23333386 these findings demonstrate that miR-221 affects the MEK/ERK pathway by targeting PAK1 to inhibit the proliferation ofendothelial progenitor cells.
23321640 Data suggest that regulation of PAK-PIX interactions controls neurite outgrowth by influencing the activity of several important mediators of actin filament polymerization and retrograde flow, as well as integrin-dependent adhesion to laminin.
23317503 The Nef/hnRNPK/PKC-delta/Hck protein complex activates Pak2 activity but inhibits Pak1 activity, which induces paxillin phosphorylation on Ser272/274 and regulates paxillin/TACE association and secretion
23300274 High expression of the PAK1 gene was significantly associated with resistance to all three PI3K inhibitors in lymphomas.
23298303 Positive rates of Rac1, Pak1 and Rock1 expression in normal tissue, dysplasia and gastric carcinoma show an increasing trend and are correlated with tumor lymph node metastasis and TNM stage.
23258534 Gene array data revealed reduced expression of matrix metalloproteinase 9 with the ablation of either Pak1 or Pak6 gene expression in PC3 cells.
23246867 data suggest that glucose-mediated activation of Cdc42 leads to activation of PAK1 and prompts activation of its downstream targets Raf-1, MEK1/2 and ERK1/2 to elicit F-actin remodeling and recruitment of insulin granules to the plasma membrane
23233484 Results support a role for the PAK4 and PAK1 in the proliferation of mutant KRAS-driven colorectal carcinoma cells via pathways not involving RAF/MEK/ERK and PI3K/AKT signaling.
23227982 The Nef/hnRNPK/PKC-delta/Hck protein complex activates Pak2 activity but inhibits Pak1 activity, which induces paxillin phosphorylation on Ser272/274 and regulates paxillin/TACE association and secretion
23055517 PAK1 phosphorylates MCAK and regulates both its localization and function.
23038262 PAK1 negatively regulates the expression of TFPI and additionally contributes to increased TF activity.
23019370 Pak-1 interacts with Wnt signaling to regulate tissue polarity and gene expression.
23017497 Phosphoproteome analyses reveal specific implications of Hcls1, p21-activated kinase 1 and Ezrin in proliferation of a myeloid progenitor cell line downstream of wild-type and ITD mutant Fms-like tyrosine kinase 3 receptors.
22983922 Results show a strong positive correlation between advanced stage and grade and PAK1 expression in skin cnacer.
22945935 In the title.
22848689 the role of PAK1 in the promotion of cell motility, cell invasiveness and the down regulation of p120-catenin through CRK serine 41 phosphorylation in NSCLC cells
22845716 PI3K, Rac1 and PAK1 may play important roles in the pathogenesis of EMPD.
22493453 results show that a STRADalpha-rac1-PAK1 pathway regulates cell polarity and invasion in LKB1-null cells. It also suggests that while the function of LKB1 and STRADalpha undoubtedly overlap, they may also have mutually exclusive roles
22465675 The Nef/hnRNPK/PKC-delta/Hck protein complex activates Pak2 activity but inhibits Pak1 activity, which induces paxillin phosphorylation on Ser272/274 and regulates paxillin/TACE association and secretion
22458949 In both anterior cingulate cortex (ACC) and dorsolateral prefrontal cortex (DLPFC), study found a reduction of Duo expression and PAK1 phosphorylation in schizophrenia. Cdc42 protein expression was decreased in ACC but not in DLPFC
22416254 PAK1 plays an important role in regulating the migration, invasion and production and activity of MMPs in RA FLS, which is mediated by the JNK pathway.
22369945 these results provide evidence that PAK1 specifically phosphorylates beta-catenin at S663 and that this phosphorylation is essential for the PAK1-mediated transcriptional activation of beta-catenin.
22293972 Pak1 is overexpressed in gastric cancer and plays an important role in the metastasis of gastric cancer. The mechanism by which Pak1 induces cancer metastasis may involve activation of ERK and JNK.
22252525 Data suggest that targeting P21-activated protein kinase1 (PAK1) may represent a novel treatment strategy for developing novel chemotherapeutic agents.
22153498 crystal structures of the phosphorylated and unphosphorylated PAK1 kinase domain.
22130069 Smad4 suppresses the PAK1, which promotes the PUMA destabilization
22105362 PAK1 as a breast cancer oncogene that coordinately regulates multiple signaling pathways
22105346 A Rac-PAK1-Ajuba feedback loop integrates spatiotemporal signaling with actin remodeling at cell-cell contacts and stabilizes preassembled cadherin complexes.
22100495 In colorectal neoplasms p-21 activated kinase 1 knockdown inhibits beta-catenin signalling and blocks cell proliferation and migration.
22096607 Findings demonstrate that Pak1 phosphorylates BAD directly at S111, but phosphorylated S112 through Raf-1.
21982772 These results provide evidence for the importance of PAK1 activation during influenza virus infection and its association with ERK in regulating virus replication.
21969371 Inhibition or ablation of p21-activated kinase (PAK1) disrupts glucose homeostatic mechanisms in vivo.
21892329 The Nef/hnRNPK/PKC-delta/Hck protein complex activates Pak2 activity but inhibits Pak1 activity, which induces paxillin phosphorylation on Ser272/274 and regulates paxillin/TACE association and secretion
21822311 a Rac1/PAK1 cascade controls beta-catenin S675 phosphorylation and full activation in colon cancer cells
21748785 results suggest that CIB1 positively regulates cell migration and is necessary for the recruitment of FAK to the focal adhesions. Furthermore, CIB1-induced cell migration is dependent on MAP kinase signaling and its function is attenuated by PAK1
21727092 increased activation of associated PAK1 can contribute to enhanced Cx43 dephosphorylation and impaired intercellular coupling that may underlie slow conduction in heart failure
21722895 Interleukin-1beta up-regulates Pak1 expression in endometrial stromal cells and Pak1 immunoreactivity is increased in endometriotic cysts.
21719533 Adapter protein Nck sequesters PAK1 in the cytoplasm and that coexpression of both PAK1 and Nck inhibits the amplifying effect of PRL-induced PAK1 on cyclin D1 promoter activity.
21653999 Contribution of the PAK family member, PAK1, in growth factor signaling and tumorigenesis.
21562048 The Nef/hnRNPK/PKC-delta/Hck protein complex activates Pak2 activity but inhibits Pak1 activity, which induces paxillin phosphorylation on Ser272/274 and regulates paxillin/TACE association and secretion
21310649 The importance of PIK3K/PAK in neoplasm transformation and progression, their disregulation detected in oral squamous cell carcer may provide early diagnosis and aid in the design of new therapies.
21209852 the PI3K/PAK1/ERK signaling pathway has a role in LPA-stimulated breast cancer cell migration
21070974 These findings expand the role of phosphoinositides in kinase signaling and suggest how altered phosphoinositide metabolism may upregulate Pak1 activity in cancer cells.
20811717 Results suggest that activated Pak1 regulates colorectal cancer metastasis requiring an ERK-dependent phosphorylation of FAK at Ser-910.
20729389 Data show that the protective effects of atrial natriuretic peptide against lipopolysaccharide-induced vascular leak are mediated at least in part by PAK1-dependent signaling leading to endothelial cell barrier enhancement.
20595063 P21-activated kinase 1 stimulates colon cancer cell growth and migration/invasion via ERK- and AKT-dependent pathways.
20594957 The Nef/hnRNPK/PKC-delta/Hck protein complex activates Pak2 activity but inhibits Pak1 activity, which induces paxillin phosphorylation on Ser272/274 and regulates paxillin/TACE association and secretion
20591216 Expression of PAK1 is an early molecular event in the tumorigenesis of gastric carcinoma. It is also closely correlated the development of gastric carcinoma and the patients' prognosis.
20526801 Rac1/Pak1 signaling is critical to MB cell migration and is functionally dependent on PDGFRbeta/ERK activity
20523167 Rac1/Cdc42/PAK pathway controls actin reorganization that is necessary for microvesicle shedding
20508983 Observational study of gene-disease association. (HuGE Navigator)
20457839 Pak1-induced branching morphogenesis in 3D MDCK cell culture requires PIX binding and beta1-integrin signaling.
20426825 Suggest that Rac1 activity and Pak1 are involved in lymphovascular invasion and lymph node metastasis of urothelial carcinoma of the upper urinary tract , and may be prognostic markers for this disease.
20417602 A functional requirement for PAK1 binding to the KH(2) domain of the fragile X protein- related FXR1 is reported.
20413688 Data reveal the involvement of p21-Activated kinase 1 in the pathogenesis and clinical progress of gestational trophoblastic disease.
20400510 PAK1 is a direct downstream target of LKB1 and plays an essential role in LKB1-induced suppression of cell migration
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20213082 PKA-induced phosphorylation of ERalpha at serine 305 and high PAK1 levels is associated with sensitivity to tamoxifen in ER-positive breast cancer.
20179234 Our results suggest that patients with tumors expressing Pak1 and pERalpha(ser305) in combination are a group in which tamoxifen treatment is insufficient
20131316 Our studies suggest that Rac1 --> Pak1/Pak2 --> NFkappaB is a separate pathway that contributes to the expression of COX-2 in HPV-induced papillomas, independently of the previously described Rac1 --> p38 --> COX-2 pathway.
20083228 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20079895 A possible role of Pak1 in the establishment of adenomyosis.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20001745 PAK-1 and its activator Rac1 are novel HIF-1 targets that may constitute a positive-feedback loop for induction of HIF-1alpha by thrombin and ROS, thus explaining elevated levels of PAK-1, Rac1, and HIF-1alpha in remodeled pulmonary vessels.
19819966 Data identify a novel signaling pathway in the endocrine L cell, whereby Cdc42 regulates actin remodeling, activation of the cannonical 1/2-ERK1/2 pathway and PAK1, and GLP-1 secretion in response to insulin.
19747561 Basic properties of group I Paks are summarized discuss recently uncovered roles for these kinases in immune function and in viral infection are discussed.
19628037 Knockdown of PAK1 inhibits Hepatocyte Growth Factor (HGF) stimulated migration and loss of cell-cell junctions in DU145 prostate carcinoma cells. In PC3 prostate carcinoma cells, knockdown of PAK1 reduces HGF-stimulated migration.
19610058 Overexpression of Pak1 was associated with progression, metastasis and prognosis of gastric cancer.
19574218 a model for the complex and accurate regulation of PAK1 kinase in vivo at cell protrusions.
19557173 LC8 facilitates nuclear import of Pak1 and this function is indispensable during vertebrate development
19520772 study identified p21 activated kinase 1 (PAK1) as a new CDK11(p58) substrate; mapped a new phosphorylation site of Ser174 on PAK1; results indicated PAK1 may serve as a downstream effector of CDK11(p58) during mitosis progression
19298660 We identified a novel mechanism for MMP-9 expression in response to injury signals, which is mediated by PAK1 activation
19296259 Overexpression of PAK1 protein is closely associated with the malignant histological and invasive phenotype of colorectal carcinoma.
19165420 Pak protein kinases have a role in cancer [review]
19162178 Pak1 protein plays a critical role in Hepatocyte Growth Factor-induced WASF2 protein transport and lamellipodia formation by directing Pak1 protein-WASF2 protein-kinesin complex.
19146681 The Nef/hnRNPK/PKC-delta/Hck protein complex activates Pak2 activity but inhibits Pak1 activity, which induces paxillin phosphorylation on Ser272/274 and regulates paxillin/TACE association and secretion
19136554 TH1 interacts with PAK1 and specifically restricts the activation of MAPK modules through the upstream region of the MAPK pathway, thereby influencing cell migration.
18923061 Expression of active p21-activated kinase-1 induces Ca2+ flux modification with altered regulatory protein phosphorylation in cardiac myocytes.
18922890 Pak1 is a target of miR-7 and that HoxD10 plays a regulatory role in modifying the expression of miR-7.
18787380 Data examine possible allelic imbalance in papillary thyroid cancer at EMSY, CAPN5, and PAK1, as candidate genes within 11q13.5-q14 region using a single nucleotide polymorphism-based analysis.
18676874 PAK1-specific paxillin phosphorylation at Ser(273) is critically involved in positive-feedback regulation.
18656238 In Cox analysis, higher p21-activated kinase-1 staining extent independently correlated with longer progression-free survival (P = .016) and shorter overall survival (.049) in primary diagnosis and disease recurrence effusions.
18653452 The Nef/hnRNPK/PKC-delta/Hck protein complex activates Pak2 activity but inhibits Pak1 activity, which induces paxillin phosphorylation on Ser272/274 and regulates paxillin/TACE association and secretion
18586681 1) PAK plays a required role in hyperosmotic signaling through the PI3K/pTEN/Cdc42/PP2Calpha/p38 pathway, and 2) PAK and PP2Calpha modulate the effects of this pathway on focal adhesion dynamics.
18448666 alpha2beta1 integrin clustering defines its own entry pathway that is Pak1 dependent but clathrin and caveolin independent and that is able to sort cargo to caveosomes
18411304 Pak1 and Pak2 mediate tumor cell invasion through distinct signaling mechanisms
18392133 Overexpression of p21-activated kinase 1 may be a key coordinator of aberrant cell survival and proteolysis in breast cancer progression.
18354494 These results provide an insight into the molecular mechanisms of CtBP1/BARS activation in membrane fissioning, and extend the relevance of CtBP1/BARS-induced fission to human viral infection.
18347024 p21-activated kinase-aberrant activation and translocation may have a role in Alzheimer disease pathogenesis
18344974 Clathrin-independent endocytosis used by the IL-2 receptor is regulated by Rac1, Pak1 and Pak2.
18319303 The data indicate that PAK1 is at the interface between junction destabilization and increased motility during morphogenetic events.
18314909 In an ovarian carcinoma cohort, RSF1 was amplified in 15% of the cases. It was correlated with serous histology. The 11q13 amplicon in ovarian cancer is likely driven by a cassette of genes rather than by a single oncogene.
18160398 a VAV1-Rac1-PAK1 signaling axis in mononuclear phagocytes regulating superoxide production in a stimulus-dependent manner.
18065495 Pak1 overexpression enhanced htt toxicity in cell models and neurons in parallel with its ability to promote aggregation, while Pak1 knockdown suppressed both aggregation and toxicity
18006851 16k PRL inhibits cell migration by blocking the Ras-Tiam1-Rac1-Pak1 signaling pathway in endothelial cells
17981134 Rac1/Pak1/LIMK1 signaling pathway controls cofilin activity within the lamellipodium.
17911169 study reports that elevated (alpha6)beta4 integrin-dependent Rac-Pak1 signaling supports resistance to apoptosis in mammary acini by permitting stress-dependent activation of the p65 subunit of NF-kappaB through Pak1
17621631 point to Pak1 as an exciting target for therapy of renal cancer, which remains highly refractory to existing treatments
17609315 we present a model for Pak1 signaling that provides a mechanism for specifically affecting cardiac cellular processes--REVIEW
17491012 ESE-1 functions are coordinately regulated by Pak1 phosphorylation and beta-TrCP-dependent ubiquitin-proteasome pathways.
17486065 Amplification of PAK1 is associated with recurrence and tamoxifen resistance in postmenopausal breast cancer
17420447 PAK1 is a physiological upstream kinase for integrin-linked kinase (ILK); PAK1 depletion dramatically increases the nuclear and focal point accumulation of ILK.
17355222 Results demonstrate a novel mechanism of signal termination mediated by the Rho-family GTPases Chp and Cdc42, which results in ubiquitin-mediated degradation of one of their direct effectors, Pak1.
17255101 p70 S6 kinase activates PAK1 and contributes to phosphatidylinositol 3-kinase- and ERK-mediated regulation of HCV RNA replication
17018616 TGF-ss, via PI3K, recruits the actin cytoskeleton to HER2, which colocalizes with Vav2, activated Rac1, & its effector Pak1 at lamellipodia, leading to prolonged Rac1 activation, enhanced cell motility & survival. Dominant-negative Pak1 abrogates this.
17012749 Akt1 and Akt2 have opposing roles in Rac/Pak signaling and cell migration
16845324 Increased p21-activated kinase-1 expression is associated with invasive potential in uveal melanoma
16800003 Phosphorylation of caldesmon by PAK is a dynamic process required to regulate actin dynamics and membrane protrusions in wound-induced cell migration.
16705121 Our data support a role for Pak1, particular Pak1 localized to the nucleus, in ERalpha signaling and in tamoxifen resistance.
16611744 Myosin II-B resides in a complex with p21-activated kinase 1 (PAK1) and atypical protein kinase C (PKC) zeta (aPKCzeta) and the interaction between these proteins is EGF-dependent.
16490785 PI3K through p21-activated kinase 1 regulates FRA-1 proto-oncogene induction by cigarette smoke and the subsequent activation of the Elk1 and cAMP-response element-binding protein transcription factors
16449192 Results show that PAK1 cooperate with different Rho effectors to regulate matrix contraction.
16407834 the SH3 domain of betaPix specifically interacts with a proline-arginine motif (PxxxPR) present within the ubiquitin ligase Cbl and Pak1 kinase. Cbl and Pak1 compete for binding to betaPix.
16091223 The Nef/hnRNPK/PKC-delta/Hck protein complex activates Pak2 activity but inhibits Pak1 activity, which induces paxillin phosphorylation on Ser272/274 and regulates paxillin/TACE association and secretion
16026643 p21-activated kinase 1 has a role in the suppression of anoikis in breast cancer cells
16002401 Data suggest that nischarin, in addition to regulating the p21-activated kinase (PAK) strand of Rac1 signaling, can also regulate other links in the web of Rac1 signaling pathways.
15893667 1.8 A resolution structure for the free PAK1 kinase domain was determined.
15864311 PAK1 recruitment to the T cell-antigen-presenting cell interface required interaction with PIX.
15849194 Pak1-dependent Raf-1 phosphorylation regulates its mitochondrial localization, phosphorylation of BAD, and Bcl-2 association
15833848 The regulation of phosphorylation and function of Snail by Pak1 represents a novel mechanism by which a signaling kinase might contribute to the process of epithelial-mesenchymal transition.
15831477 PAK1 phosphorylation of tubulin cofactor B (TCoB)is essential for the polymerization of new microtubules.
15824732 Pak1-SHARP interaction plays an essential role in enhancing the corepressor functions of SHARP, thereby modulating Notch1 signaling in human cancer cells.
15749698 These findings define the nuclear localization signals (NLSs) of Pak1, its association with chromatin, and the resulting modulation of transcription, thus opening new avenues to further the search for nuclear Pak1 functions.
15684429 PAK1 negatively regulates the activity of NET1
15638726 The Nef/hnRNPK/PKC-delta/Hck protein complex activates Pak2 activity but inhibits Pak1 activity, which induces paxillin phosphorylation on Ser272/274 and regulates paxillin/TACE association and secretion
15611088 epithelial cell motility is modulated by integrin engagment through RhoA/ROCK and PAK1
15561713 NF-kappaB- and C/EBPbeta-driven interleukin-1beta gene expression and PAK1-mediated caspase-1 activation play essential roles in interleukin-1beta release from Helicobacter pylori lipopolysaccharide-stimulated macrophages
15378030 cell signaling kinase Pak1 is a novel regulator of glucose metabolism through its phosphorylation and regulation of PGM activity.
15333633 PAK is a central regulator of endothelial permeability induced by multiple growth factors and cytokines via an effect on cell contractility
15225553 These results support a role for Pak1-mediated RhoGDI phosphorylation as a mechanism for Cdc42-mediated Rac activation, and suggest the possibility of Rac-induced positive feed-forward regulation of Rac activity.
15161701 Pak-1 has a role in human colorectal tumor invasiveness and motility
15059930 Src- & ROS-dependent PDK1 activation leads to site-specific PAK1 phosphorylation. This is critically important for PDGF-induced VSMC migration, a process integral to the vascular response to injury that leads to vessel occlusion & plaque formation.
15047871 PAK2 is constitutively activated in certain breast cancer cell lines and that this active PAK is mislocalized to atypical focal adhesions in the absence of high levels of activated Rho GTPases.
14749719 Phosphorylation of p41-ARC protein by p21-activated kinase 1.
14694110 Tat induces actin cytoskeletal rearrangements through PAK1 in human umbilical vein endothelial cells
14694110 The Nef/hnRNPK/PKC-delta/Hck protein complex activates Pak2 activity but inhibits Pak1 activity, which induces paxillin phosphorylation on Ser272/274 and regulates paxillin/TACE association and secretion
14607331 Observational study of gene-disease association. (HuGE Navigator)
14530270 Pak1 regulation of cyclin D1 expression might involve an NF-kappaB-dependent pathway; Pak1 is up-regulated in breast tumors
12937139 PAK1 copy number gains were observed in 30% of ovarian carcinomas and PAK1 protein was expressed in 85% of tumors. PAK1 gains were associated with high grade.
12912914 PAK1 regulates contact inhibition during epithelial wound healing.
12887923 G beta gamma binds PAK1 and, via PAK-associated PIX alpha, activates Cdc42 which, in turn, activates PAK1. In this pathway, PAK1 is not only an effector for Cdc42, but it also functions as a scaffold protein required for Cdc42 activation.
12887916 Activated Cdc42 at the leading edge of a neutrophil in culture helps orient the cell's axis in a signaling complex with G beta gamma, PAK1, and PIXalpha.
12734410 The Nef/hnRNPK/PKC-delta/Hck protein complex activates Pak2 activity but inhibits Pak1 activity, which induces paxillin phosphorylation on Ser272/274 and regulates paxillin/TACE association and secretion
12560069 results identify a novel signaling pathway linking estrogen action to Pak1 signaling, and Pak1 to FKHR, suggesting that Pak1 is an important mediator of estrogen's cell survival functions
12551923 role in phosphorylating Raf-1 regulates Raf-1 autoinhibition
12531429 phorbol ester induced cell migration is accompanied by selective and transient down-regulation of PAK1, which coincided with the formation of stress fibres.
12522133 p21-activated kinase 1 (PAK1) interacts with the Grb2 adapter protein to couple to growth factor signaling
12453877 Cdc42/Rac1-dependent activation of PAK may trigger early platelet shape change, at least in part through the regulation of cortactin binding to PAK.
12198493 FLNa may be essential for Pak1-induced cytoskeletal reorganization
12151336 Pak1 interacts with and phosphorylates histone H3 and may thus influence the Pak1-histone H3 pathway, which in turn may influence mitotic events in breast cancer cells
12011045 binding of the Rho family member Cdc42 to PLD1 and the subsequent stimulation of its enzymatic activity are distinct events
12009866 The Nef/hnRNPK/PKC-delta/Hck protein complex activates Pak2 activity but inhibits Pak1 activity, which induces paxillin phosphorylation on Ser272/274 and regulates paxillin/TACE association and secretion
11948406 PAK1 primes MEK1 for phosphorylation by Raf-1 kinase during cross-cascade activation of the ERK pathway.
11804587 Pak1 forms homodimers in vivo and its dimerization is regulated by the intracellular level of GTP-Cdc42 or GTP-Rac1
11689886 The Nef/hnRNPK/PKC-delta/Hck protein complex activates Pak2 activity but inhibits Pak1 activity, which induces paxillin phosphorylation on Ser272/274 and regulates paxillin/TACE association and secretion
11463741 The Nef/hnRNPK/PKC-delta/Hck protein complex activates Pak2 activity but inhibits Pak1 activity, which induces paxillin phosphorylation on Ser272/274 and regulates paxillin/TACE association and secretion
10713183 The Nef/hnRNPK/PKC-delta/Hck protein complex activates Pak2 activity but inhibits Pak1 activity, which induces paxillin phosphorylation on Ser272/274 and regulates paxillin/TACE association and secretion
10559302 The Nef/hnRNPK/PKC-delta/Hck protein complex activates Pak2 activity but inhibits Pak1 activity, which induces paxillin phosphorylation on Ser272/274 and regulates paxillin/TACE association and secretion
9792838 The Nef/hnRNPK/PKC-delta/Hck protein complex activates Pak2 activity but inhibits Pak1 activity, which induces paxillin phosphorylation on Ser272/274 and regulates paxillin/TACE association and secretion
9371615 The Nef/hnRNPK/PKC-delta/Hck protein complex activates Pak2 activity but inhibits Pak1 activity, which induces paxillin phosphorylation on Ser272/274 and regulates paxillin/TACE association and secretion
9070423 The Nef/hnRNPK/PKC-delta/Hck protein complex activates Pak2 activity but inhibits Pak1 activity, which induces paxillin phosphorylation on Ser272/274 and regulates paxillin/TACE association and secretion
8939608 The Nef/hnRNPK/PKC-delta/Hck protein complex activates Pak2 activity but inhibits Pak1 activity, which induces paxillin phosphorylation on Ser272/274 and regulates paxillin/TACE association and secretion
8862424 The Nef/hnRNPK/PKC-delta/Hck protein complex activates Pak2 activity but inhibits Pak1 activity, which induces paxillin phosphorylation on Ser272/274 and regulates paxillin/TACE association and secretion
8709288 The Nef/hnRNPK/PKC-delta/Hck protein complex activates Pak2 activity but inhibits Pak1 activity, which induces paxillin phosphorylation on Ser272/274 and regulates paxillin/TACE association and secretion
8709241 The Nef/hnRNPK/PKC-delta/Hck protein complex activates Pak2 activity but inhibits Pak1 activity, which induces paxillin phosphorylation on Ser272/274 and regulates paxillin/TACE association and secretion
8108442 The Nef/hnRNPK/PKC-delta/Hck protein complex activates Pak2 activity but inhibits Pak1 activity, which induces paxillin phosphorylation on Ser272/274 and regulates paxillin/TACE association and secretion
7797518 The Nef/hnRNPK/PKC-delta/Hck protein complex activates Pak2 activity but inhibits Pak1 activity, which induces paxillin phosphorylation on Ser272/274 and regulates paxillin/TACE association and secretion

AA Sequence

MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEK      1 - 70
ERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQ     71 - 140
KYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLP    141 - 210
VTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGA    211 - 280
SGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGG    281 - 350
SLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSK    351 - 420
RSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKL    421 - 490
SAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH                   491 - 545
//

Text Mined References (341)

PMID Year Title
27012601 2016 GIT1/?PIX signaling proteins and PAK1 kinase regulate microtubule nucleation.
27003261 2016 PAK1 translocates into nucleus in response to prolactin but not to estrogen.
26809475 2016 Neuronal filopodium formation induced by the membrane glycoprotein M6a (Gpm6a) is facilitated by coronin-1a, Rac1, and p21-activated kinase 1 (Pak1).
26774265 2016 FRAX597, a PAK1 inhibitor, synergistically reduces pancreatic cancer growth when combined with gemcitabine.
26547035 2016 NOTCH1 intracellular domain negatively regulates PAK1 signaling pathway through direct interaction.
26379399 2015 ?-elemene enhances the radiosensitivity of gastric cancer cells by inhibiting Pak1 activation.
26377044 2015 Potentially functional polymorphisms in PAK1 are associated with risk of lung cancer in a Chinese population.
26255026 2015 Cx43 increases serum induced filopodia formation via activation of p21-activated protein kinase 1.
26218748 2015 p21-Activated Kinases 1, 2 and 4 in Endometrial Cancers: Effects on Clinical Outcomes and Cell Proliferation.
26160174 2015 The Role of the Pleckstrin Homology Domain-containing Protein CKIP-1 in Activation of p21-activated Kinase 1 (PAK1).
26104863 2015 Disruption of p21-activated kinase 1 gene diminishes atherosclerosis in apolipoprotein E-deficient mice.
26078008 2015 Cdk1 phosphorylates the Rac activator Tiam1 to activate centrosomal Pak and promote mitotic spindle formation.
26036343 2015 PAK1 modulates a PPAR?/NF-?B cascade in intestinal inflammation.
26023713 2015 Dysregulation of PAK1 Is Associated with DNA Damage and Is of Prognostic Importance in Primary Esophageal Small Cell Carcinoma.
26004135 2015 Rich1 negatively regulates the epithelial cell cycle, proliferation and adhesion by CDC42/RAC1-PAK1-Erk1/2 pathway.
25981171 2015 Altered expression of CDC42 signaling pathway components in cortical layer 3 pyramidal cells in schizophrenia.
25956913 2015 Significance of KRAS/PAK1/Crk pathway in non-small cell lung cancer oncogenesis.
25888627 2015 PAK1-mediated MORC2 phosphorylation promotes gastric tumorigenesis.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25843002 2015 Cancer cell-autonomous TRAIL-R signaling promotes KRAS-driven cancer progression, invasion, and metastasis.
25791829 2015 P21-activated kinase 1 and 4 were associated with colorectal cancer metastasis and infiltration.
25766321 2015 PAK1 regulates RUFY3-mediated gastric cancer cell migration and invasion.
25746720 2015 P21 activated kinase-1 mediates transforming growth factor ?1-induced prostate cancer cell epithelial to mesenchymal transition.
25675297 2015 p21-activated kinase 1 determines stem-like phenotype and sunitinib resistance via NF-?B/IL-6 activation in renal cell carcinoma.
25596744 2015 Group I Paks as therapeutic targets in NF2-deficient meningioma.
25569743 2015 Overexpression of PAK1 promotes cell survival in inflammatory bowel diseases and colitis-associated cancer.
25472536 2015 Tyrosyl phosphorylated serine-threonine kinase PAK1 is a novel regulator of prolactin-dependent breast cancer cell motility and invasion.
25466889 2015 Phosphorylation of tyrosine 285 of PAK1 facilitates ?PIX/GIT1 binding and adhesion turnover.
25456130 2014 Regulation of Stat5 by FAK and PAK1 in Oncogenic FLT3- and KIT-Driven Leukemogenesis.
25447917 2015 The investigation of miR-221-3p and PAK1 gene expressions in breast cancer cell lines.
25416956 2014 A proteome-scale map of the human interactome network.
25416031 2014 PAK1 is a novel cardiac protective signaling molecule.
25415869 2015 Inhibitors of p21-activated kinases (PAKs).
25412958 2015 Clinicopathological and cellular signature of PAK1 in human bladder cancer.
25388666 2015 Erk5 inhibits endothelial migration via KLF2-dependent down-regulation of PAK1.
25327287 2015 Axl as a downstream effector of TGF-?1 via PI3K/Akt-PAK1 signaling pathway promotes tumor invasion and chemoresistance in breast carcinoma.
25228413 2014 BRAF activates and physically interacts with PAK to regulate cell motility.
25215948 2015 Polycomb-mediated loss of microRNA let-7c determines inflammatory macrophage polarization via PAK1-dependent NF-?B pathway.
25182632 2014 Reduced expression of p21-activated protein kinase 1 correlates with poor histological differentiation in pancreatic cancer.
25159681 2015 Personalizing risk stratification by addition of PAK1 expression to TNM staging: improving the accuracy of clinical decision for gastroesophageal junction adenocarcinoma.
25125660 2014 PAK1 tyrosine phosphorylation is required to induce epithelial-mesenchymal transition and radioresistance in lung cancer cells.
25074413 2014 PAK1 mediates pancreatic cancer cell migration and resistance to MET inhibition.
25019394 [The role of protein kinase PAK1 in the regulation of estrogen-independent growth of breast cancer].
24954107 2014 miR-145 inhibits invasion of bladder cancer cells by targeting PAK1.
24935174 2014 Whole genome gene copy number profiling of gastric cancer identifies PAK1 and KRAS gene amplification as therapy targets.
24859002 2014 A Trio-Rac1-Pak1 signalling axis drives invadopodia disassembly.
24811999 2014 Tracing PAKs from GI inflammation to cancer.
24792722 2014 Nox1 activation by ?Pix and the role of Ser-340 phosphorylation.
24634274 2015 Association of p21-activated kinase-1 activity with aggressive tumor behavior and poor prognosis of head and neck cancer.
24625804 2014 Caveolin-1 mediates Salmonella invasion via the regulation of SopE-dependent Rac1 activation and actin reorganization.
24561527 2015 Transcriptional regulation of fibronectin by p21-activated kinase-1 modulates pancreatic tumorigenesis.
24347489 2014 Axl gene knockdown inhibits the metastasis properties of hepatocellular carcinoma via PI3K/Akt-PAK1 signal pathway.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24236193 2013 Prognostic importance and therapeutic implications of PAK1, a drugable protein kinase, in gastroesophageal junction adenocarcinoma.
23885116 2013 Protein kinase CK2 phosphorylates and activates p21-activated kinase 1.
23811795 2013 N-acetylglucosaminyltransferase V confers hepatoma cells with resistance to anoikis through EGFR/PAK1 activation.
23811286 2013 P21-activated kinase 1 promotes colorectal cancer survival by up-regulation of hypoxia-inducible factor-1?.
23744893 2013 PAK1 regulates breast cancer cell invasion through secretion of matrix metalloproteinases in response to prolactin and three-dimensional collagen IV.
23737530 2013 Nuclear factor of activated T cells c1 mediates p21-activated kinase 1 activation in the modulation of chemokine-induced human aortic smooth muscle cell F-actin stress fiber formation, migration, and proliferation and injury-induced vascular wall remodeling.
23653349 2013 p21-activated kinase 1 (PAK1) can promote ERK activation in a kinase-independent manner.
23633677 2013 ?-arrestin-dependent activation of the cofilin pathway is required for the scavenging activity of the atypical chemokine receptor D6.
23622267 2013 Group I p21-activated kinases facilitate Tax-mediated transcriptional activation of the human T-cell leukemia virus type 1 long terminal repeats.
23613712 2013 PAK1 protein expression in the auditory cortex of schizophrenia subjects.
23576562 2013 Pak1 kinase links ErbB2 to ?-catenin in transformation of breast epithelial cells.
23535073 2013 P21-activated kinase 1 (PAK1) as a therapeutic target in BRAF wild-type melanoma.
23516476 2013 Klotho endows hepatoma cells with resistance to anoikis via VEGFR2/PAK1 activation in hepatocellular carcinoma.
23503467 2014 A novel splice variant of calcium and integrin-binding protein 1 mediates protein kinase D2-stimulated tumour growth by regulating angiogenesis.
23499762 2013 HGF and IGF-1 synergize with SDF-1? in promoting migration of myeloma cells by cooperative activation of p21-activated kinase.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23393142 2013 Synergistic activation of p21-activated kinase 1 by phosphatidylinositol 4,5-bisphosphate and Rho GTPases.
23340249 2013 Tyrosyl phosphorylated PAK1 regulates breast cancer cell motility in response to prolactin through filamin A.
23338047 2013 Overexpression of p21-activated kinase 1 promotes endometrial cancer progression.
23333386 2013 Increased expression of microRNA-221 inhibits PAK1 in endothelial progenitor cells and impairs its function via c-Raf/MEK/ERK pathway.
23321640 2013 PAK-PIX interactions regulate adhesion dynamics and membrane protrusion to control neurite outgrowth.
23300274 2013 PAK1 mediates resistance to PI3K inhibition in lymphomas.
23298303 2014 Expression and significance of Rac1, Pak1 and Rock1 in gastric carcinoma.
23258534 2013 P21 activated kinase-1 (Pak1) promotes prostate tumor growth and microinvasion via inhibition of transforming growth factor ? expression and enhanced matrix metalloproteinase 9 secretion.
23246867 2013 A p21-activated kinase (PAK1) signaling cascade coordinately regulates F-actin remodeling and insulin granule exocytosis in pancreatic ? cells.
23233484 2013 Knockdown of PAK4 or PAK1 inhibits the proliferation of mutant KRAS colon cancer cells independently of RAF/MEK/ERK and PI3K/AKT signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23175184 2013 Blebbishields, the emergency program for cancer stem cells: sphere formation and tumorigenesis after apoptosis.
23055517 2012 Signaling-dependent phosphorylation of mitotic centromere-associated kinesin regulates microtubule depolymerization and its centrosomal localization.
23038262 2012 p21-activated kinase-1 signaling regulates transcription of tissue factor and tissue factor pathway inhibitor.
23019370 2012 p21-activated kinase interacts with Wnt signaling to regulate tissue polarity and gene expression.
23017497 2013 Phosphoproteome analyses reveal specific implications of Hcls1, p21-activated kinase 1 and Ezrin in proliferation of a myeloid progenitor cell line downstream of wild-type and ITD mutant Fms-like tyrosine kinase 3 receptors.
22983922 2012 p21-Activated kinase 1 is required for efficient tumor formation and progression in a Ras-mediated skin cancer model.
22945935 2012 CYK4 inhibits Rac1-dependent PAK1 and ARHGEF7 effector pathways during cytokinesis.
22848689 2012 PAK1 kinase promotes cell motility and invasiveness through CRK-II serine phosphorylation in non-small cell lung cancer cells.
22845716 2012 PI3K, Rac1 and pPAK1 are overexpressed in extramammary Paget's disease.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22669945 2012 Synapses of amphids defective (SAD-A) kinase promotes glucose-stimulated insulin secretion through activation of p21-activated kinase (PAK1) in pancreatic ?-Cells.
22581261 2012 DOCK8 functions as an adaptor that links TLR-MyD88 signaling to B cell activation.
22493453 2012 STE20-related kinase adaptor protein ? (STRAD?) regulates cell polarity and invasion through PAK1 signaling in LKB1-null cells.
22458949 2012 Abnormalities of the Duo/Ras-related C3 botulinum toxin substrate 1/p21-activated kinase 1 pathway drive myosin light chain phosphorylation in frontal cortex in schizophrenia.
22419666 2012 Genome wide study of maternal and parent-of-origin effects on the etiology of orofacial clefts.
22416254 2012 Role of p21-activated kinase 1 in regulating the migration and invasion of fibroblast-like synoviocytes from rheumatoid arthritis patients.
22369945 2012 Phosphorylation of ?-catenin at serine 663 regulates its transcriptional activity.
22293972 2012 P21-activated protein kinase 1 is overexpressed in gastric cancer and induces cancer metastasis.
22252525 2012 PAK1-dependent MAPK pathway activation is required for colorectal cancer cell proliferation.
22153498 2011 Structural insights into the autoactivation mechanism of p21-activated protein kinase.
22130069 2011 Novel tumor suppressive function of Smad4 in serum starvation-induced cell death through PAK1-PUMA pathway.
22117219 2012 IAPs regulate the plasticity of cell migration by directly targeting Rac1 for degradation.
22105362 2012 PAK1 is a breast cancer oncogene that coordinately activates MAPK and MET signaling.
22105346 2011 Ajuba is required for Rac activation and maintenance of E-cadherin adhesion.
22100495 2012 P-21 activated kinase 1 knockdown inhibits ?-catenin signalling and blocks colorectal cancer growth.
22096607 2011 p21-Activated kinase 1 (Pak1) phosphorylates BAD directly at serine 111 in vitro and indirectly through Raf-1 at serine 112.
21982772 2011 Role of the p21-activated kinases (PAKs) in influenza A virus replication.
21969371 2011 Inhibition or ablation of p21-activated kinase (PAK1) disrupts glucose homeostatic mechanisms in vivo.
21822311 2012 A Rac1/PAK1 cascade controls ?-catenin activation in colon cancer cells.
21748785 2011 Contra-regulation of calcium- and integrin-binding protein 1-induced cell migration on fibronectin by PAK1 and MAP kinase signaling.
21727092 2011 Enhanced activation of p21-activated kinase 1 in heart failure contributes to dephosphorylation of connexin 43.
21722895 2011 Up-regulation of p21-activated kinase 1 by in vitro treatment with interleukin 1-beta and its increased expression in ovarian endometriotic cysts.
21719533 2011 PAK1-Nck regulates cyclin D1 promoter activity in response to prolactin.
21653999 2011 p21-activated kinase 1: PAK'ed with potential.
21454543 2011 Rac1 protein rescues neurite retraction caused by G2019S leucine-rich repeat kinase 2 (LRRK2).
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21310649 2011 The frequent co-expression of the oncogenes PIK3CA and PAK1 in oral carcinomas.
21269460 2011 Initial characterization of the human central proteome.
21209852 2010 Lysophosphatidic acid induces MDA-MB-231 breast cancer cells migration through activation of PI3K/PAK1/ERK signaling.
21167153 2011 Invasion of breast cancer cells into collagen matrix requires TGF-? and Cdc42 signaling.
21070974 2010 Phosphoinositides are essential coactivators for p21-activated kinase 1.
21029865 2010 EphB-mediated degradation of the RhoA GEF Ephexin5 relieves a developmental brake on excitatory synapse formation.
20936779 2010 A human MAP kinase interactome.
20811717 2010 P21-activated protein kinase 1 induces colorectal cancer metastasis involving ERK activation and phosphorylation of FAK at Ser-910.
20810653 2010 srGAP2 arginine methylation regulates cell migration and cell spreading through promoting dimerization.
20729389 2010 Atrial natriuretic peptide attenuates LPS-induced lung vascular leak: role of PAK1.
20595063 2010 P21-activated kinase 1 stimulates colon cancer cell growth and migration/invasion via ERK- and AKT-dependent pathways.
20591216 2010 Correlations of P21-activated kinase 1 expression to clinicopathological features of gastric carcinoma and patients' prognosis.
20526801 2010 ERK activation of p21 activated kinase-1 (Pak1) is critical for medulloblastoma cell migration.
20523167 2009 Activation of PAK1/2 during the shedding of platelet microvesicles.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20457839 2010 Pak1 regulates branching morphogenesis in 3D MDCK cell culture by a PIX and beta1-integrin-dependent mechanism.
20426825 2010 Increased Rac1 activity and Pak1 overexpression are associated with lymphovascular invasion and lymph node metastasis of upper urinary tract cancer.
20417602 2010 A functional requirement for PAK1 binding to the KH(2) domain of the fragile X protein-related FXR1.
20413688 2010 p21-Activated kinase-1 promotes aggressive phenotype, cell proliferation, and invasion in gestational trophoblastic disease.
20400510 2010 LKB1 suppresses p21-activated kinase-1 (PAK1) by phosphorylation of Thr109 in the p21-binding domain.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20213082 2011 PKA-induced phosphorylation of ER? at serine 305 and high PAK1 levels is associated with sensitivity to tamoxifen in ER-positive breast cancer.
20179234 2010 Estrogen receptor-alpha phosphorylation at serine 305, nuclear p21-activated kinase 1 expression, and response to tamoxifen in postmenopausal breast cancer.
20131316 2010 Pak1 and Pak2 are activated in recurrent respiratory papillomas, contributing to one pathway of Rac1-mediated COX-2 expression.
20083228 2010 Genome-wide analysis of chromosomal alterations in patients with esophageal squamous cell carcinoma exposed to tobacco and betel quid from high-risk area in India.
20079895 2010 Increased expression of p21-activated kinase in adenomyosis.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
20001745 2010 Reciprocal regulation of Rac1 and PAK-1 by HIF-1alpha: a positive-feedback loop promoting pulmonary vascular remodeling.
19893577 2009 The adenomatous polyposis coli-associated exchange factors Asef and Asef2 are required for adenoma formation in Apc(Min/+)mice.
19819966 2009 The rho guanosine 5'-triphosphatase, cell division cycle 42, is required for insulin-induced actin remodeling and glucagon-like peptide-1 secretion in the intestinal endocrine L cell.
19747561 2010 Group I p21-activated kinases: emerging roles in immune function and viral pathogenesis.
19732720 2009 14-3-3zeta Cooperates with ErbB2 to promote ductal carcinoma in situ progression to invasive breast cancer by inducing epithelial-mesenchymal transition.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19667065 2009 Identification of novel in vivo phosphorylation sites of the human proapoptotic protein BAD: pore-forming activity of BAD is regulated by phosphorylation.
19628037 2009 PAK1 and PAK2 have different roles in HGF-induced morphological responses.
19610058 2009 Downregulation of p21-activated kinase-1 inhibits the growth of gastric cancer cells involving cyclin B1.
19596003 2009 Adiponectin promotes migration activities of endothelial progenitor cells via Cdc42/Rac1.
19574218 2009 Dissecting activation of the PAK1 kinase at protrusions in living cells.
19557173 2009 Interaction with LC8 is required for Pak1 nuclear import and is indispensable for zebrafish development.
19520772 2009 CDK11p58 phosphorylation of PAK1 Ser174 promotes DLC2 binding and roles on cell cycle progression.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19298660 2009 Tumor necrosis factor-alpha induced expression of matrix metalloproteinase-9 through p21-activated kinase-1.
19296259 2009 [Clinicopathological significance of expression and amplification of P21-activated kinase 1 gene in colorectal carcinoma].
19270716 2009 ISG15 modification of filamin B negatively regulates the type I interferon-induced JNK signalling pathway.
19165420 2009 Pak protein kinases and their role in cancer.
19162178 2009 Membrane transport of WAVE2 and lamellipodia formation require Pak1 that mediates phosphorylation and recruitment of stathmin/Op18 to Pak1-WAVE2-kinesin complex.
19136554 2009 Trihydrophobin 1 Interacts with PAK1 and Regulates ERK/MAPK Activation and Cell Migration.
18923061 2009 Expression of active p21-activated kinase-1 induces Ca2+ flux modification with altered regulatory protein phosphorylation in cardiac myocytes.
18922890 2008 MicroRNA-7, a homeobox D10 target, inhibits p21-activated kinase 1 and regulates its functions.
18854161 2008 ACF7 regulates cytoskeletal-focal adhesion dynamics and migration and has ATPase activity.
18787380 2008 Absence of allelic imbalance involving EMSY, CAPN5, and PAK1 genes in papillary thyroid carcinoma.
18716323 2008 Scrib regulates PAK activity during the cell migration process.
18676874 2008 Cross talk between paxillin and Rac is critical for mediation of barrier-protective effects by oxidized phospholipids.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18656238 2008 Different clinical roles for p21-activated kinase-1 in primary and recurrent ovarian carcinoma.
18586681 2008 PAK is regulated by PI3K, PIX, CDC42, and PP2Calpha and mediates focal adhesion turnover in the hyperosmotic stress-induced p38 pathway.
18448666 2008 A Raft-derived, Pak1-regulated entry participates in alpha2beta1 integrin-dependent sorting to caveosomes.
18411304 2008 Pak1 and Pak2 mediate tumor cell invasion through distinct signaling mechanisms.
18392133 2008 p21-Activated kinase 1 coordinates aberrant cell survival and pericellular proteolysis in a three-dimensional culture model for premalignant progression of human breast cancer.
18354494 2008 The closure of Pak1-dependent macropinosomes requires the phosphorylation of CtBP1/BARS.
18347024 2008 p21-activated kinase-aberrant activation and translocation in Alzheimer disease pathogenesis.
18344974 2008 Clathrin-independent endocytosis used by the IL-2 receptor is regulated by Rac1, Pak1 and Pak2.
18325335 2008 Affixin activates Rac1 via betaPIX in C2C12 myoblast.
18319303 2008 PAK is required for the disruption of E-cadherin adhesion by the small GTPase Rac.
18314909 2008 Amplification of 11q13 in ovarian carcinoma.
18160398 2008 Stimulus-dependent regulation of the phagocyte NADPH oxidase by a VAV1, Rac1, and PAK1 signaling axis.
18086875 2008 The atypical Rho GTPase Wrch1 collaborates with the nonreceptor tyrosine kinases Pyk2 and Src in regulating cytoskeletal dynamics.
18065495 2008 p21-activated kinase 1 promotes soluble mutant huntingtin self-interaction and enhances toxicity.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18006851 2007 16-kDa prolactin inhibits endothelial cell migration by down-regulating the Ras-Tiam1-Rac1-Pak1 signaling pathway.
17989089 2007 Identification of phosphorylation sites in betaPIX and PAK1.
17981134 2007 Cofilin activity downstream of Pak1 regulates cell protrusion efficiency by organizing lamellipodium and lamella actin networks.
17911169 2007 alpha6beta4 integrin activates Rac-dependent p21-activated kinase 1 to drive NF-kappaB-dependent resistance to apoptosis in 3D mammary acini.
17726028 2007 JAK2 tyrosine kinase phosphorylates PAK1 and regulates PAK1 activity and functions.
17621631 2007 Modulation of p21-activated kinase 1 alters the behavior of renal cell carcinoma.
17609315 2007 p21-Activated kinase-1 and its role in integrated regulation of cardiac contractility.
17491012 2007 Phosphorylation-dependent regulation of stability and transforming potential of ETS transcriptional factor ESE-1 by p21-activated kinase 1.
17486065 2007 Amplification of CCND1 and PAK1 as predictors of recurrence and tamoxifen resistance in postmenopausal breast cancer.
17420447 2007 Phosphorylation-dependent regulation of nuclear localization and functions of integrin-linked kinase.
17355222 2007 Autophosphorylation-dependent degradation of Pak1, triggered by the Rho-family GTPase, Chp.
17255101 2007 p21-activated kinase 1 is activated through the mammalian target of rapamycin/p70 S6 kinase pathway and regulates the replication of hepatitis C virus in human hepatoma cells.
17245428 2007 Rac1-induced cell migration requires membrane recruitment of the nuclear oncogene SET.
17060906 2006 VEGF controls endothelial-cell permeability by promoting the beta-arrestin-dependent endocytosis of VE-cadherin.
17018616 2006 HER2/Neu (ErbB2) signaling to Rac1-Pak1 is temporally and spatially modulated by transforming growth factor beta.
17012749 2006 Opposing roles for Akt1 and Akt2 in Rac/Pak signaling and cell migration.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16845324 2006 Increased p21-activated kinase-1 expression is associated with invasive potential in uveal melanoma.
16800003 2006 Requirement of reversible caldesmon phosphorylation at P21-activated kinase-responsive sites for lamellipodia extensions during cell migration.
16705121 2006 Association between Pak1 expression and subcellular localization and tamoxifen resistance in breast cancer patients.
16628223 2006 GIT2 represses Crk- and Rac1-regulated cell spreading and Cdc42-mediated focal adhesion turnover.
16611744 2006 PAK1 and aPKCzeta regulate myosin II-B phosphorylation: a novel signaling pathway regulating filament assembly.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16492808 2006 Targeting and activation of Rac1 are mediated by the exchange factor beta-Pix.
16490785 2006 A Phosphatidylinositol 3-kinase-regulated Akt-independent signaling promotes cigarette smoke-induced FRA-1 expression.
16449192 2006 P21-activated kinase 1: convergence point in PDGF- and LPA-stimulated collagen matrix contraction by human fibroblasts.
16413544 2006 Induction of apoptosis by p110C requires mitochondrial translocation of the proapoptotic BCL-2 family member BAD.
16407834 2006 Cbl escapes Cdc42-mediated inhibition by downregulation of the adaptor molecule betaPix.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16278681 2006 CRIPak, a novel endogenous Pak1 inhibitor.
16246732 2005 An electrostatic steering mechanism of Cdc42 recognition by Wiskott-Aldrich syndrome proteins.
16204230 2005 Regulation of the interaction of Pak2 with Cdc42 via autophosphorylation of serine 141.
16101281 2005 Structural analysis of the SH3 domain of beta-PIX and its interaction with alpha-p21 activated kinase (PAK).
16061695 2005 Essential role of CIB1 in regulating PAK1 activation and cell migration.
16033904 2005 Angiotensin II-induced activation of p21-activated kinase 1 requires Ca2+ and protein kinase C{delta} in vascular smooth muscle cells.
16026643 2005 Active p21-activated kinase 1 rescues MCF10A breast epithelial cells from undergoing anoikis.
16002401 2005 Regulation of p21-activated kinase-independent Rac1 signal transduction by nischarin.
15893667 2005 The active conformation of the PAK1 kinase domain.
15864311 2005 Dynamic recruitment of PAK1 to the immunological synapse is mediated by PIX independently of SLP-76 and Vav1.
15849194 2005 p21-activated Kinase 1 (Pak1)-dependent phosphorylation of Raf-1 regulates its mitochondrial localization, phosphorylation of BAD, and Bcl-2 association.
15833848 2005 Pak1 phosphorylation of snail, a master regulator of epithelial-to-mesenchyme transition, modulates snail's subcellular localization and functions.
15831477 2005 p21-activated kinase 1 regulates microtubule dynamics by phosphorylating tubulin cofactor B.
15824732 2005 An essential role of Pak1 phosphorylation of SHARP in Notch signaling.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15749698 2005 Nuclear localization and chromatin targets of p21-activated kinase 1.
15688026 2005 Cooperation and selectivity of the two Grb2 binding sites of p52Shc in T-cell antigen receptor signaling to Ras family GTPases and Myc-dependent survival.
15684429 2005 PAK1 negatively regulates the activity of the Rho exchange factor NET1.
15611088 2005 Integrin engagement differentially modulates epithelial cell motility by RhoA/ROCK and PAK1.
15597056 2004 Adhesion molecule L1 stimulates neuronal migration through Vav2-Pak1 signaling.
15561713 2005 NF-kappaB- and C/EBPbeta-driven interleukin-1beta gene expression and PAK1-mediated caspase-1 activation play essential roles in interleukin-1beta release from Helicobacter pylori lipopolysaccharide-stimulated macrophages.
15556869 2004 Atypical mechanism of regulation of the Wrch-1 Rho family small GTPase.
15542607 2005 Adhesion stimulates direct PAK1/ERK2 association and leads to ERK-dependent PAK1 Thr212 phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15378030 2004 Regulation of phosphoglucomutase 1 phosphorylation and activity by a signaling kinase.
15350535 2004 Wrch1 is a GTPase-deficient Cdc42-like protein with unusual binding characteristics and cellular effects.
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15333633 2004 p21-activated kinase regulates endothelial permeability through modulation of contractility.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15225553 2004 Phosphorylation of RhoGDI by Pak1 mediates dissociation of Rac GTPase.
15169762 2004 The Down syndrome cell adhesion molecule (DSCAM) interacts with and activates Pak.
15161701 2004 Pak-1 expression increases with progression of colorectal carcinomas to metastasis.
15059930 2004 Phosphoinositide-dependent kinase 1 and p21-activated protein kinase mediate reactive oxygen species-dependent regulation of platelet-derived growth factor-induced smooth muscle cell migration.
15047871 2004 Constitutive p21-activated kinase (PAK) activation in breast cancer cells as a result of mislocalization of PAK to focal adhesions.
14970201 2004 p21-activated kinase 1 phosphorylates and regulates 14-3-3 binding to GEF-H1, a microtubule-localized Rho exchange factor.
14749719 2004 p41-Arc subunit of human Arp2/3 complex is a p21-activated kinase-1-interacting substrate.
14707132 2004 Characterization of OSR1, a member of the mammalian Ste20p/germinal center kinase subfamily.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14694110 2004 Human immunodeficiency virus type 1 Tat regulates endothelial cell actin cytoskeletal dynamics through PAK1 activation and oxidant production.
14607331 2003 Association between p21 codon 31 polymorphism and esophageal cancer risk in a Taiwanese population.
14585966 2003 Akt phosphorylation of serine 21 on Pak1 modulates Nck binding and cell migration.
14580336 2003 Merlin, the product of the Nf2 tumor suppressor gene, is an inhibitor of the p21-activated kinase, Pak1.
14579272 2003 p38 MAPK is a critical regulator of the constitutive and the beta4 integrin-regulated expression of IL-6 in human normal thymic epithelial cells.
14530270 2004 p21-activated kinase-1 signaling mediates cyclin D1 expression in mammary epithelial and cancer cells.
14521508 2004 Rho GTPases have diverse effects on the organization of the actin filament system.
12937139 2003 Combined array comparative genomic hybridization and tissue microarray analysis suggest PAK1 at 11q13.5-q14 as a critical oncogene target in ovarian carcinoma.
12912914 2003 Pak1 and PIX regulate contact inhibition during epithelial wound healing.
12887923 2003 Directional sensing requires G beta gamma-mediated PAK1 and PIX alpha-dependent activation of Cdc42.
12887916 2003 Two poles and a compass.
12879077 2003 RhoG activates Rac1 by direct interaction with the Dock180-binding protein Elmo.
12876277 2003 PAK1 phosphorylation of MEK1 regulates fibronectin-stimulated MAPK activation.
12855698 2003 Vascular endothelial growth factor causes translocation of p47phox to membrane ruffles through WAVE1.
12624090 2003 The C-terminal kinase domain of the p34cdc2-related PITSLRE protein kinase (p110C) associates with p21-activated kinase 1 and inhibits its activity during anoikis.
12606577 2003 Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6.
12560069 2003 Estrogen regulation of Pak1 and FKHR pathways in breast cancer cells.
12551923 2003 Phosphorylation of Raf-1 by p21-activated kinase 1 and Src regulates Raf-1 autoinhibition.
12531429 2003 Phorbol ester-induced migration of HepG2 cells is accompanied by intensive stress fibre formation, enhanced integrin expression and transient down-regulation of p21-activated kinase 1.
12522133 2003 p21-activated kinase 1 (PAK1) interacts with the Grb2 adapter protein to couple to growth factor signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12453877 2002 Cdc42/Rac1-dependent activation of the p21-activated kinase (PAK) regulates human platelet lamellipodia spreading: implication of the cortical-actin binding protein cortactin.
12374744 2002 P21-activated kinase-1 phosphorylates and transactivates estrogen receptor-alpha and promotes hyperplasia in mammary epithelium.
12237306 2002 Synapsin I is phosphorylated at Ser603 by p21-activated kinases (PAKs) in vitro and in PC12 cells stimulated with bradykinin.
12198493 2002 Filamin is essential in actin cytoskeletal assembly mediated by p21-activated kinase 1.
12189148 2002 A p21-activated kinase-controlled metabolic switch up-regulates phagocyte NADPH oxidase.
12154000 2002 Fibroblast growth factor receptor substrate 2 participates in vascular endothelial growth factor-induced signaling.
12151336 2002 p21-activated kinase 1 interacts with and phosphorylates histone H3 in breast cancer cells.
12138087 2002 Adhesion-related kinase repression of gonadotropin-releasing hormone gene expression requires Rac activation of the extracellular signal-regulated kinase pathway.
12089369 2002 Phosphatidylinositol 3-kinase controls antineutrophil cytoplasmic antibodies-induced respiratory burst in human neutrophils.
12085993 2002 Basic fibroblast growth factor-induced translocation of p21-activated kinase to the membrane is independent of phospholipase C-gamma1 in the differentiation of PC12 cells.
12011045 2002 Specificity of Rho insert-mediated activation of phospholipase D1.
12006652 2002 Paxillin-dependent paxillin kinase linker and p21-activated kinase localization to focal adhesions involves a multistep activation pathway.
11956071 2002 Forced expression of NESH suppresses motility and metastatic dissemination of malignant cells.
11950930 2002 VE-cadherin regulates endothelial actin activating Rac and increasing membrane association of Tiam.
11950598 2002 Analysis of the subcellular distribution of avian p95-APP2, an ARF-GAP orthologous to mammalian paxillin kinase linker.
11950587 2002 p21-activated kinases: three more join the Pak.
11948406 2002 PAK1 primes MEK1 for phosphorylation by Raf-1 kinase during cross-cascade activation of the ERK pathway.
11864573 2002 The p21-activated kinase PAK is negatively regulated by POPX1 and POPX2, a pair of serine/threonine phosphatases of the PP2C family.
11804587 2002 Pak1 kinase homodimers are autoinhibited in trans and dissociated upon activation by Cdc42 and Rac1.
11733498 2002 Interaction between active Pak1 and Raf-1 is necessary for phosphorylation and activation of Raf-1.
11719502 2002 p21-activated kinase links Rac/Cdc42 signaling to merlin.
11604394 2001 Phosphorylation of Pak1 by the p35/Cdk5 kinase affects neuronal morphology.
11604131 2001 Plexin signaling via off-track and rho family GTPases.
11557983 2001 The SH2/SH3 adaptor Grb4 transduces B-ephrin reverse signals.
11397816 2001 Involvement of Hgs/Hrs in signaling for cytokine-mediated c-fos induction through interaction with TAK1 and Pak1.
11382770 2001 Etk/Bmx tyrosine kinase activates Pak1 and regulates tumorigenicity of breast cancer cells.
11371639 2001 Regulation of the p21-activated kinase (PAK) by a human Gbeta -like WD-repeat protein, hPIP1.
11340065 2001 Activation of LIM kinases by myotonic dystrophy kinase-related Cdc42-binding kinase alpha.
11278486 2001 The mechanism of PAK activation. Autophosphorylation events in both regulatory and kinase domains control activity.
11278241 2001 Cell adhesion regulates the interaction between Nck and p21-activated kinase.
11157752 2001 A PAK1-PIX-PKL complex is activated by the T-cell receptor independent of Nck, Slp-76 and LAT.
11134022 2001 Oligomerization of Rac1 gtpase mediated by the carboxyl-terminal polybasic domain.
11030651 2000 Localized Rac activation dynamics visualized in living cells.
10995762 2000 p21-activated kinase (PAK1) is phosphorylated and activated by 3-phosphoinositide-dependent kinase-1 (PDK1).
10975528 2000 Structure of PAK1 in an autoinhibited conformation reveals a multistage activation switch.
10967094 2000 Characterization of TCL, a new GTPase of the rho family related to TC10 andCcdc42.
10938077 2000 Tumor necrosis factor alpha-induced phosphorylation of RelA/p65 on Ser529 is controlled by casein kinase II.
10805734 2000 Interaction between PAK and nck: a template for Nck targets and role of PAK autophosphorylation.
10772928 2000 Role of the recombinant non-integrin platelet collagen receptor P65 on platelet activation induced by convulxin.
10652353 2000 Rho-associated kinase ROCK activates LIM-kinase 1 by phosphorylation at threonine 508 within the activation loop.
10611223 2000 p21-activated kinase 1 phosphorylates the death agonist bad and protects cells from apoptosis.
10559936 1999 Activation of LIM-kinase by Pak1 couples Rac/Cdc42 GTPase signalling to actin cytoskeletal dynamics.
10551809 1999 Identification of a central phosphorylation site in p21-activated kinase regulating autoinhibition and kinase activity.
10461188 1999 Pak to the future.
10358014 1999 Negative regulation of the forkhead transcription factor FKHR by Akt.
10330411 1999 Paxillin LD4 motif binds PAK and PIX through a novel 95-kD ankyrin repeat, ARF-GAP protein: A role in cytoskeletal remodeling.
10330410 1999 p21-activated kinase 1 (Pak1) regulates cell motility in mammalian fibroblasts.
10205168 1999 Serine and tyrosine phosphorylations cooperate in Raf-1, but not B-Raf activation.
10092231 1999 Inhibition of myosin light chain kinase by p21-activated kinase.
10075701 1999 Multisite autophosphorylation of p21-activated protein kinase gamma-PAK as a function of activation.
10026169 1999 Identification of Grb4/Nckbeta, a src homology 2 and 3 domain-containing adapter protein having similar binding and biological properties to Nck.
9852149 1998 The localization of myosin VI at the golgi complex and leading edge of fibroblasts and its phosphorylation and recruitment into membrane ruffles of A431 cells after growth factor stimulation.
9823899 1998 The protein kinase Pak3 positively regulates Raf-1 activity through phosphorylation of serine 338.
9774445 1998 Heregulin regulates cytoskeletal reorganization and cell migration through the p21-activated kinase-1 via phosphatidylinositol-3 kinase.
9774440 1998 Differential effects of PAK1-activating mutations reveal activity-dependent and -independent effects on cytoskeletal regulation.
9705280 1998 Structural requirements for PAK activation by Rac GTPases.
9659915 1998 PAK kinases are directly coupled to the PIX family of nucleotide exchange factors.
9533029 1997 Detailed map of a region commonly amplified at 11q13-->q14 in human breast carcinoma.
9528787 1998 A conserved negative regulatory region in alphaPAK: inhibition of PAK kinases reveals their morphological roles downstream of Cdc42 and Rac1.
9395435 1997 Human p21-activated kinase (Pak1) regulates actin organization in mammalian cells.
9351825 1997 Cross-cascade activation of ERKs and ternary complex factors by Rho family proteins.
9298982 1997 Localization of p21-activated kinase 1 (PAK1) to pinocytic vesicles and cortical actin structures in stimulated cells.
9234708 1997 Phosphorylation of Raf-1 serine 338-serine 339 is an essential regulatory event for Ras-dependent activation and biological signaling.
9032240 1997 Expression of constitutively active alpha-PAK reveals effects of the kinase on actin and focal complexes.
8824201 1996 Interaction of the Nck adapter protein with p21-activated kinase (PAK1).
8805275 1996 Human Ste20 homologue hPAK1 links GTPases to the JNK MAP kinase pathway.
8107774 1994 A brain serine/threonine protein kinase activated by Cdc42 and Rac1.
7744004 1995 A novel serine kinase activated by rac1/CDC42Hs-dependent autophosphorylation is related to PAK65 and STE20.