Property Summary

Ligand Count 80
NCBI Gene PubMed Count 361
PubMed Score 237.82
PubTator Score 357.05

Knowledge Summary

Patent (25,992)

Expression

  Differential Expression (24)

Disease log2 FC p
adult high grade glioma -1.700 1.0e-02
astrocytic glioma -2.800 1.5e-03
Astrocytoma, Pilocytic -1.900 1.5e-04
atypical teratoid / rhabdoid tumor -1.500 9.3e-03
cystic fibrosis 1.312 2.0e-04
ependymoma -2.700 3.9e-03
glioblastoma -1.600 2.3e-05
group 3 medulloblastoma -1.400 1.4e-02
intraductal papillary-mucinous adenoma (... 1.300 1.6e-02
intraductal papillary-mucinous carcinoma... 1.300 2.5e-02
intraductal papillary-mucinous neoplasm ... 1.400 3.0e-03
lung cancer 1.400 8.5e-03
lung carcinoma 1.100 3.8e-19
malignant mesothelioma -3.400 4.5e-08
medulloblastoma, large-cell -1.300 2.4e-02
non-small cell lung cancer 1.895 7.5e-18
oligodendroglioma -2.400 1.6e-02
osteosarcoma 1.312 1.9e-06
ovarian cancer -1.400 6.2e-06
pancreatic cancer 1.200 6.4e-06
Pick disease -1.800 2.1e-03
primitive neuroectodermal tumor -1.900 1.4e-03
subependymal giant cell astrocytoma -2.099 1.2e-02
tuberculosis 1.100 3.5e-03

PDB (30)

Gene RIF (263)

AA Sequence

MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEK      1 - 70
ERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQ     71 - 140
KYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLP    141 - 210
VTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGA    211 - 280
SGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGG    281 - 350
SLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSK    351 - 420
RSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKL    421 - 490
SAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH                   491 - 545
//

Text Mined References (379)

PMID Year Title