Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1663 1.4e-03
osteosarcoma 7933 2.3e-02

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.009 2.3e-02
diabetes mellitus 1.200 1.4e-03

AA Sequence

MSEHVRTRSQSSERGNDQESSQPVGSVIVQEPTEEKRQEEEPPTDNQGIAPSGEIENEGAPAVQGPDMEA      1 - 70
FQQELALLKIEDEPGDGPDVREGIMPTFDLTKVLEAGDAQP                                  71 - 111
//

Text Mined References (4)

PMID Year Title
16341674 2005 Transcriptome analysis of human gastric cancer.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.